(data stored in ACNUC7421 zone)

EMBL: CP001622.PE39

CP001622.PE39        Location/Qualifiers
FT   CDS             35996..36424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0040"
FT                   /product="Peptidase M15A"
FT                   /note="PFAM: Peptidase M15A; protein of unknown function
FT                   DUF882; KEGG: rec:RHECIAT_CH0000425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54351"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC7"
FT                   /inference="protein motif:PFAM:PF08291"
FT                   /protein_id="ACS54351.1"
FT                   /translation="MQNAILLAIAGLFAFQSATGAVGQDMKRHAVHLAKHQARLAYTVQ
FT                   TVSVRAGCFPGRLRAVLSHIAAKTGRRPVITSGHRPHPRRHGSLHGKCLAADFRMPGLS
FT                   ERTIIAAARSAPGIGGIGSYCNGIIHVDVGPQRRWVDC"
     MQNAILLAIA GLFAFQSATG AVGQDMKRHA VHLAKHQARL AYTVQTVSVR AGCFPGRLRA        60
     VLSHIAAKTG RRPVITSGHR PHPRRHGSLH GKCLAADFRM PGLSERTIIA AARSAPGIGG       120
     IGSYCNGIIH VDVGPQRRWV DC                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page