(data stored in ACNUC7421 zone)

EMBL: CP001622.PE390

CP001622.PE390       Location/Qualifiers
FT   CDS             400418..401506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0391"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000779 alpha-glucoside ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54702"
FT                   /db_xref="GOA:C6B1I3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54702.1"
FT                   /translation="MTGLTLKDIRKSYGSVDVLHGIDLDIKQGEFIVFVGPSGCGKSTL
FT                   LRMIAGLEAITGGEMYIDGHLVNDVPPSKRGIAMVFQSYALYPHMTVFDNMAFGMKIAG
FT                   ESKQDIDRRVKAAAESLQLTQYLGRLPKALSGGQRQRVAIGRAICRDPKVFLFDEPLSN
FT                   LDAALRVATRIEIARLNEQMADTTMIYVTHDQVEAMTLADRIVVLSAGNIEQVGAPLDL
FT                   YERPANLFVAKFIGSPAMNIIPATVAGTGSQTTVTLTGGMSVTLDVATDASEMGKQASF
FT                   GVRPEDLRVADGADYLFEGEVSIVEALGEVTLLYIEGLVPGEPIVVKLPGIYDVKKGQR
FT                   MRFAADRQKLHLFDATGHTYRK"
     MTGLTLKDIR KSYGSVDVLH GIDLDIKQGE FIVFVGPSGC GKSTLLRMIA GLEAITGGEM        60
     YIDGHLVNDV PPSKRGIAMV FQSYALYPHM TVFDNMAFGM KIAGESKQDI DRRVKAAAES       120
     LQLTQYLGRL PKALSGGQRQ RVAIGRAICR DPKVFLFDEP LSNLDAALRV ATRIEIARLN       180
     EQMADTTMIY VTHDQVEAMT LADRIVVLSA GNIEQVGAPL DLYERPANLF VAKFIGSPAM       240
     NIIPATVAGT GSQTTVTLTG GMSVTLDVAT DASEMGKQAS FGVRPEDLRV ADGADYLFEG       300
     EVSIVEALGE VTLLYIEGLV PGEPIVVKLP GIYDVKKGQR MRFAADRQKL HLFDATGHTY       360
     RK                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page