(data stored in ACNUC7421 zone)

EMBL: CP001622.PE391

CP001622.PE391       Location/Qualifiers
FT   CDS             401623..402036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54703"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000780"
FT                   /protein_id="ACS54703.1"
FT                   /translation="MAASNPSQPKSHFLSKEESFMYDREARFKMEDTMNAARIEYTEKG
FT                   VMHAASRRCDIVRISMSSATLAILTQFSLPKQFYLDIPDARITKVGCLLMKVNANNTVE
FT                   VRFLRLLTQKELNKIFVYSTHPAHRDYVLDIRA"
     MAASNPSQPK SHFLSKEESF MYDREARFKM EDTMNAARIE YTEKGVMHAA SRRCDIVRIS        60
     MSSATLAILT QFSLPKQFYL DIPDARITKV GCLLMKVNAN NTVEVRFLRL LTQKELNKIF       120
     VYSTHPAHRD YVLDIRA                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page