(data stored in ACNUC7421 zone)

EMBL: CP001622.PE392

CP001622.PE392       Location/Qualifiers
FT   CDS             complement(402117..403940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0393"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000783 phosphogluconate
FT                   dehydratase protein; TIGRFAM: 6-phosphogluconate
FT                   dehydratase; PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54704"
FT                   /db_xref="GOA:C6B1I5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I5"
FT                   /inference="protein motif:TFAM:TIGR01196"
FT                   /protein_id="ACS54704.1"
FT                   /translation="MSAHARISAITDRIVERSKPSRERYLERLRAAASKGVARSVLGCA
FT                   NLAHGFAVCSPADKDALAGDRIPNLGIITAYNDMLSAHQPFETYPAIIREAAAEAGGVA
FT                   QVAGGVPAMCDGVTQGQPGMELSLFSRDLIAMSAGVGLSHNMFDAALFLGVCDKIVPGL
FT                   VIAALSFGHLPSIFVPAGPMTTGLPNDEKSRVRQLFAEGKVGRAELLEAESKSYHGPGT
FT                   CTFYGTANSNQMLMEIMGFHMPGSSFINPGTPLREALTREAAKRALAITALGNEFTPAG
FT                   EMIDERSVVNGVVGLHATGGSTNHTLHLVAMARAAGIHLTWQDIAELSEIVPLLARVYP
FT                   NGLADVNHFQAAGGMGFLIKELLKHGLVHDDVRTVFGHGLQAYTVDARLGENGAVLREP
FT                   SPEKSVDPKVLSSIETPFQANGGLKMLRGNLGKAVIKISAVKPERHIIEAPAIIFHSQQ
FT                   ELQDAFKEGKLNRDFIAVVRFQGPKANGMPELHKLTPPLGVLQDRGFRVALLTDGRMSG
FT                   ASGKVPAAIHVTPEAVDGGPIARIREGDIIRLDAIKGTLELLVDAADLAERDPVVVDLS
FT                   DNEFGMGRELFAPFRRAVGASDQGASVLFHH"
     MSAHARISAI TDRIVERSKP SRERYLERLR AAASKGVARS VLGCANLAHG FAVCSPADKD        60
     ALAGDRIPNL GIITAYNDML SAHQPFETYP AIIREAAAEA GGVAQVAGGV PAMCDGVTQG       120
     QPGMELSLFS RDLIAMSAGV GLSHNMFDAA LFLGVCDKIV PGLVIAALSF GHLPSIFVPA       180
     GPMTTGLPND EKSRVRQLFA EGKVGRAELL EAESKSYHGP GTCTFYGTAN SNQMLMEIMG       240
     FHMPGSSFIN PGTPLREALT REAAKRALAI TALGNEFTPA GEMIDERSVV NGVVGLHATG       300
     GSTNHTLHLV AMARAAGIHL TWQDIAELSE IVPLLARVYP NGLADVNHFQ AAGGMGFLIK       360
     ELLKHGLVHD DVRTVFGHGL QAYTVDARLG ENGAVLREPS PEKSVDPKVL SSIETPFQAN       420
     GGLKMLRGNL GKAVIKISAV KPERHIIEAP AIIFHSQQEL QDAFKEGKLN RDFIAVVRFQ       480
     GPKANGMPEL HKLTPPLGVL QDRGFRVALL TDGRMSGASG KVPAAIHVTP EAVDGGPIAR       540
     IREGDIIRLD AIKGTLELLV DAADLAERDP VVVDLSDNEF GMGRELFAPF RRAVGASDQG       600
     ASVLFHH                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page