(data stored in ACNUC7421 zone)

EMBL: CP001622.PE393

CP001622.PE393       Location/Qualifiers
FT   CDS             complement(404018..404716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0394"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; KEGG:
FT                   rec:RHECIAT_CH0000784 6-phosphogluconolactonase protein;
FT                   SNP /replace=G"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54705"
FT                   /db_xref="GOA:C6B1I6"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I6"
FT                   /inference="protein motif:TFAM:TIGR01198"
FT                   /protein_id="ACS54705.1"
FT                   /translation="MASTLHSFASAADLAGSLADKVADALSAAIAARGTASIAVSGGST
FT                   PKVFFQTLSTRDVAWDKVTITLVDERFVPADNPRSNHLLVDANLLQNKAKVARFLPLYQ
FT                   DAASAEEAARLATEKTRAISSPFDIVILGMGGDGHTASFFPGGSNLAKAIDASTPRGII
FT                   TMEAEGAGEPRLTFTFSSLEDAALLVLHIEGEGKKDVLAKAEGSGDEAEMPIRAVLRRA
FT                   TSPVEIYWAP"
     MASTLHSFAS AADLAGSLAD KVADALSAAI AARGTASIAV SGGSTPKVFF QTLSTRDVAW        60
     DKVTITLVDE RFVPADNPRS NHLLVDANLL QNKAKVARFL PLYQDAASAE EAARLATEKT       120
     RAISSPFDIV ILGMGGDGHT ASFFPGGSNL AKAIDASTPR GIITMEAEGA GEPRLTFTFS       180
     SLEDAALLVL HIEGEGKKDV LAKAEGSGDE AEMPIRAVLR RATSPVEIYW AP               232
//

If you have problems or comments...

PBIL Back to PBIL home page