(data stored in ACNUC7421 zone)

EMBL: CP001622.PE394

CP001622.PE394       Location/Qualifiers
FT   CDS             complement(404727..406202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0395"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: ret:RHE_CH00704 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54706"
FT                   /db_xref="GOA:C6B1I7"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I7"
FT                   /inference="protein motif:TFAM:TIGR00871"
FT                   /protein_id="ACS54706.1"
FT                   /translation="MSSQIIPVEPFDYVVFGGSGDLAERKLLPALYHRQIEGQFSEPTR
FT                   VIGASRSPLTHEEYRKFAKDALNEHLKKGEYDEAEVEKFCARLYYVSVDARTDAGWDQL
FT                   KKLLDEGKDRVRAFYLAVAPGIFGDISQKIHDHKLITKSTRIVVEKPIGRDLASALQLN
FT                   DTIGRAFKEEQIFRIDHYLGKETVQNLMALRFANALYEPLWNANYIDHVQITVAESVGL
FT                   EGRAGYYDTAGALRDMVQNHILQLLCLTAMEVPSSMDSEAVRDEKLKVLRALKPLNASN
FT                   VEQATVRGQYRAGASGSGPVKGYLEELEGGVSNTETFVAIKAEINNWRWAGVPFYIRTG
FT                   KRLTGRMSEIVITFKPIPHAIFDQAAGRINANQLIIRLQPDEGVKQSLMIKDPGPGGMR
FT                   LRNVSLDMSFAQAFNVRNPDAYERLLMDVIRSNQTLFMRRDEVEAAWKWVDPILKGWET
FT                   TGQQVQGYTAGTWGPSQAIALIERDGRTWHDEI"
     MSSQIIPVEP FDYVVFGGSG DLAERKLLPA LYHRQIEGQF SEPTRVIGAS RSPLTHEEYR        60
     KFAKDALNEH LKKGEYDEAE VEKFCARLYY VSVDARTDAG WDQLKKLLDE GKDRVRAFYL       120
     AVAPGIFGDI SQKIHDHKLI TKSTRIVVEK PIGRDLASAL QLNDTIGRAF KEEQIFRIDH       180
     YLGKETVQNL MALRFANALY EPLWNANYID HVQITVAESV GLEGRAGYYD TAGALRDMVQ       240
     NHILQLLCLT AMEVPSSMDS EAVRDEKLKV LRALKPLNAS NVEQATVRGQ YRAGASGSGP       300
     VKGYLEELEG GVSNTETFVA IKAEINNWRW AGVPFYIRTG KRLTGRMSEI VITFKPIPHA       360
     IFDQAAGRIN ANQLIIRLQP DEGVKQSLMI KDPGPGGMRL RNVSLDMSFA QAFNVRNPDA       420
     YERLLMDVIR SNQTLFMRRD EVEAAWKWVD PILKGWETTG QQVQGYTAGT WGPSQAIALI       480
     ERDGRTWHDE I                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page