(data stored in ACNUC7421 zone)

EMBL: CP001622.PE395

CP001622.PE395       Location/Qualifiers
FT   CDS             complement(406337..407635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0396"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ret:RHE_CH00705 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54707"
FT                   /db_xref="GOA:C6B1I8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I8"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS54707.1"
FT                   /translation="MASQETWQSPIAPGLSWYQATVGERPTYPALDGSRTCDVAIVGGG
FT                   YTGLQAAYNLAKSGVSVVLIEAYRFGDGASGRNGGQLGTGQRWWPEELEEKIGYERSKA
FT                   LFDLAEAAKRHLIDFAREHQIEIDYVPGQLNVAHKASYKRDYYENAEIAALRYGYPHLS
FT                   FMDEKETQERLGSKRFHCGVRDVGTGHIHPLKLLVGLARVAANAGAEIFEMTKATAIRQ
FT                   SGGKVTIETERGTITAERALIACNGHIGDLEPVTASHVMPIRSFIGATAPLDGHAGVLP
FT                   GGEAVADSRFVVRYFRKFGDGRLLFGGREAYTSDNPRDISEHIRRQIAEIYPELKDIEI
FT                   THAWGGSVGITLPRQPFVREVMPGVISIGGYSGHGVMLSNYCGKLYAETVLGTSGDLDL
FT                   FTSLDIPAFPGGARMRAPLLFLALSWFALRDKF"
     MASQETWQSP IAPGLSWYQA TVGERPTYPA LDGSRTCDVA IVGGGYTGLQ AAYNLAKSGV        60
     SVVLIEAYRF GDGASGRNGG QLGTGQRWWP EELEEKIGYE RSKALFDLAE AAKRHLIDFA       120
     REHQIEIDYV PGQLNVAHKA SYKRDYYENA EIAALRYGYP HLSFMDEKET QERLGSKRFH       180
     CGVRDVGTGH IHPLKLLVGL ARVAANAGAE IFEMTKATAI RQSGGKVTIE TERGTITAER       240
     ALIACNGHIG DLEPVTASHV MPIRSFIGAT APLDGHAGVL PGGEAVADSR FVVRYFRKFG       300
     DGRLLFGGRE AYTSDNPRDI SEHIRRQIAE IYPELKDIEI THAWGGSVGI TLPRQPFVRE       360
     VMPGVISIGG YSGHGVMLSN YCGKLYAETV LGTSGDLDLF TSLDIPAFPG GARMRAPLLF       420
     LALSWFALRD KF                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page