(data stored in ACNUC7421 zone)

EMBL: CP001622.PE396

CP001622.PE396       Location/Qualifiers
FT   CDS             complement(407648..409084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0397"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   ret:RHE_CH00706 glutamine synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54708"
FT                   /db_xref="GOA:C6B1I9"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I9"
FT                   /inference="protein motif:PRIAM:6.3.1.11"
FT                   /protein_id="ACS54708.1"
FT                   /translation="MSPKKTTLKPARNVPASKKTPPEPGSLRGVANWKEAARWLRARGI
FT                   EDIECITPDLAGVARGKMMPSSKFTSNTSLALPSAIYRHTISGEYPDETESFRYEPRDS
FT                   DLKLMPDLSTLSVVPWETDPTAQVICDIVDSDGGEVPYTPRNVLKRIMSLYHERGWKPI
FT                   VAPEIEFYLVAKNDDPDYPLHPPKGRSGRSILGGQGYSIAGINEFDELIDDVYHFSEKQ
FT                   GLEIDTLIHEEGPAQMEINLRHGNPIELADQVFLFKRTIREAALKHDIYATFMAKPMQG
FT                   QPGSAMHIHQSVVDIETGKNIFSNADGSASKEFFHFIGGMQKFVPSAMAMLAPYVNSYR
FT                   RLQPDMSCPVNNAWGYDNRTTAFRVPVSDPQARRVENRLPSSDANPYLALAASLASGLL
FT                   GIMKQIEPTAPTEDSANEGSIDLPRGLLEAVALLEDEPAFEEMFGKQFIGLYAGVKRGE
FT                   FETFMQVISPWEREFLLLNV"
     MSPKKTTLKP ARNVPASKKT PPEPGSLRGV ANWKEAARWL RARGIEDIEC ITPDLAGVAR        60
     GKMMPSSKFT SNTSLALPSA IYRHTISGEY PDETESFRYE PRDSDLKLMP DLSTLSVVPW       120
     ETDPTAQVIC DIVDSDGGEV PYTPRNVLKR IMSLYHERGW KPIVAPEIEF YLVAKNDDPD       180
     YPLHPPKGRS GRSILGGQGY SIAGINEFDE LIDDVYHFSE KQGLEIDTLI HEEGPAQMEI       240
     NLRHGNPIEL ADQVFLFKRT IREAALKHDI YATFMAKPMQ GQPGSAMHIH QSVVDIETGK       300
     NIFSNADGSA SKEFFHFIGG MQKFVPSAMA MLAPYVNSYR RLQPDMSCPV NNAWGYDNRT       360
     TAFRVPVSDP QARRVENRLP SSDANPYLAL AASLASGLLG IMKQIEPTAP TEDSANEGSI       420
     DLPRGLLEAV ALLEDEPAFE EMFGKQFIGL YAGVKRGEFE TFMQVISPWE REFLLLNV         478
//

If you have problems or comments...

PBIL Back to PBIL home page