(data stored in ACNUC7421 zone)

EMBL: CP001622.PE397

CP001622.PE397       Location/Qualifiers
FT   CDS             409173..410393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0398"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; KEGG: rec:RHECIAT_CH0000788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54709"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J0"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ACS54709.1"
FT                   /translation="MEKEDAGLIGETGLQRKSDVIVIGAGAAGMMAAIRAGKRGRSVVI
FT                   LDHARAPGEKIRISGGGRCNFTNIHAGPKNFLSANPHFCKSALARFTPADFIAMVDRHG
FT                   ITWHEKTLGQLFCDDSAKDIIRMLLAEMRAAGATLHLGTEISGVEKTESGFRVSTSEGH
FT                   CEASSLIVATGGKSIPKMGATGFAYRLAEQFGLAVLETRPGLVPLTLDPGLLESIAPLA
FT                   GIAAPAEIRHGRTGFREALLFTHRGLSGPAILQISSYWREGDEIVLAIEPDIDIAAHLK
FT                   VAKQLNGRQSPQTALGDILPKRLAQFLVEREKISGNMADLPDKALLRLAAGVQNWAVKP
FT                   SGSEGYRTAEVTLGGIDTAALDSRSMEAKAVPGLYFIGECVDVTGWLGGYNFQWAWASG
FT                   FAAGECV"
     MEKEDAGLIG ETGLQRKSDV IVIGAGAAGM MAAIRAGKRG RSVVILDHAR APGEKIRISG        60
     GGRCNFTNIH AGPKNFLSAN PHFCKSALAR FTPADFIAMV DRHGITWHEK TLGQLFCDDS       120
     AKDIIRMLLA EMRAAGATLH LGTEISGVEK TESGFRVSTS EGHCEASSLI VATGGKSIPK       180
     MGATGFAYRL AEQFGLAVLE TRPGLVPLTL DPGLLESIAP LAGIAAPAEI RHGRTGFREA       240
     LLFTHRGLSG PAILQISSYW REGDEIVLAI EPDIDIAAHL KVAKQLNGRQ SPQTALGDIL       300
     PKRLAQFLVE REKISGNMAD LPDKALLRLA AGVQNWAVKP SGSEGYRTAE VTLGGIDTAA       360
     LDSRSMEAKA VPGLYFIGEC VDVTGWLGGY NFQWAWASGF AAGECV                      406
//

If you have problems or comments...

PBIL Back to PBIL home page