(data stored in ACNUC7421 zone)

EMBL: CP001622.PE398

CP001622.PE398       Location/Qualifiers
FT   CDS             410638..410781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54710"
FT                   /db_xref="GOA:C6B1J1"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J1"
FT                   /inference="similar to AA sequence:KEGG:Arad_0951"
FT                   /protein_id="ACS54710.1"
FT                   /translation="MNRNARRARAIAIAEAKPNARMVALRYLMLAAGATAASLALLLSH
FT                   FI"
     MNRNARRARA IAIAEAKPNA RMVALRYLML AAGATAASLA LLLSHFI                      47
//

If you have problems or comments...

PBIL Back to PBIL home page