(data stored in ACNUC7421 zone)

EMBL: CP001622.PE399

CP001622.PE399       Location/Qualifiers
FT   CDS             411095..413626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0400"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: rec:RHECIAT_CH0000790 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54711"
FT                   /db_xref="GOA:C6B1J2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J2"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54711.1"
FT                   /translation="MLIDKILSRFRIKTKVLIFVLPFVVTISAVGLTGLYASGLLQGRM
FT                   EISNSVLQSLSGFKDLYGSMDDFLRVTSPEARDKLSADLKIQQGVLDQTLSQVGDEAAG
FT                   RDSLAEASRRTKEISGVVDKLWALHEQEQALHEQIDAAQKSVISTRFTVSYQAEQLQST
FT                   VQSDESAATSTLRTADRLLKGGDFLGTVASGFSKPQTPQDKIAFINEQMPEIIKSQRLI
FT                   AISVPSNQKNVIEALAATIDGIKAIVQTPNPTDETATELGRLVSRFRQTSTYTQLTATQ
FT                   KMRDATQEFAALDGRIAQANSVLQDTRRLENSVYSLQIVLSDFLADSSKENLVRLQQQA
FT                   GTLGKDMQVLVTSAKGMGFAEGISGAIQPALDVISGGGSKIVDTIGERVTAYAAARQEL
FT                   DQIWKKLTDFAELQKQTAGTERTQANSISVMTTGLGILLSILGGIALVLTLQRPISHIT
FT                   AAMRRIAEGALDTSISGEQRHDEIGDMARALGIFKENAISKIRIEEQSDEERAAAEHER
FT                   LRNDAEKREMDRQIEFAVNALAAGLERMSQGDISTTIETPFIGRLEQLRQDFNGSMMRL
FT                   QATMSQIRDNVELIQGNGNQMAQSAEDLSKRTEQQAASLEETAAAVDQITVTVRSSAER
FT                   AKDADQIVRQAKRSADDSAVVVSNAIDAMSRIEGASRQIEQIIGVIDEIAFQTNLLALN
FT                   AGIEAARAGEAGKGFAVVAMEVRELAQRSAAAAQEIKGLINKSTNEVNSGSQFVQETGT
FT                   VLAKISAQIVTISQHVEMIARASHDQSNALQSVNATVNQMDQMTQQNAAMVEETTAASR
FT                   ELADEAGSLRRLIQQFKIDGEATSAPVYRAA"
     MLIDKILSRF RIKTKVLIFV LPFVVTISAV GLTGLYASGL LQGRMEISNS VLQSLSGFKD        60
     LYGSMDDFLR VTSPEARDKL SADLKIQQGV LDQTLSQVGD EAAGRDSLAE ASRRTKEISG       120
     VVDKLWALHE QEQALHEQID AAQKSVISTR FTVSYQAEQL QSTVQSDESA ATSTLRTADR       180
     LLKGGDFLGT VASGFSKPQT PQDKIAFINE QMPEIIKSQR LIAISVPSNQ KNVIEALAAT       240
     IDGIKAIVQT PNPTDETATE LGRLVSRFRQ TSTYTQLTAT QKMRDATQEF AALDGRIAQA       300
     NSVLQDTRRL ENSVYSLQIV LSDFLADSSK ENLVRLQQQA GTLGKDMQVL VTSAKGMGFA       360
     EGISGAIQPA LDVISGGGSK IVDTIGERVT AYAAARQELD QIWKKLTDFA ELQKQTAGTE       420
     RTQANSISVM TTGLGILLSI LGGIALVLTL QRPISHITAA MRRIAEGALD TSISGEQRHD       480
     EIGDMARALG IFKENAISKI RIEEQSDEER AAAEHERLRN DAEKREMDRQ IEFAVNALAA       540
     GLERMSQGDI STTIETPFIG RLEQLRQDFN GSMMRLQATM SQIRDNVELI QGNGNQMAQS       600
     AEDLSKRTEQ QAASLEETAA AVDQITVTVR SSAERAKDAD QIVRQAKRSA DDSAVVVSNA       660
     IDAMSRIEGA SRQIEQIIGV IDEIAFQTNL LALNAGIEAA RAGEAGKGFA VVAMEVRELA       720
     QRSAAAAQEI KGLINKSTNE VNSGSQFVQE TGTVLAKISA QIVTISQHVE MIARASHDQS       780
     NALQSVNATV NQMDQMTQQN AAMVEETTAA SRELADEAGS LRRLIQQFKI DGEATSAPVY       840
     RAA                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page