(data stored in ACNUC7421 zone)

EMBL: CP001622.PE4

CP001622.PE4         Location/Qualifiers
FT   CDS             complement(4105..4749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0004"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   rec:RHECIAT_CH0000400 probable nucleoside-triphosphatase
FT                   protein, HAM1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54316"
FT                   /db_xref="GOA:C6AY92"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY92"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ACS54316.1"
FT                   /translation="MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPD
FT                   ETGTSFEENATIKAVASANASGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFD
FT                   MAMAKVEKALQDAGATKPEQRTARFISVLCLAWPDGHTELFRGEVEGSVVWPPRGTQGF
FT                   GYDPVFQPEGYDITFGEMSGEEKHGWNVGKPQALSHRARAFKLFVETCLEA"
     MRKLETKTIV VASHNAGKIR EIQELIGPLG FTAKSAAELN FVEPDETGTS FEENATIKAV        60
     ASANASGMPA LSDDSGLVVD ALGGDPGVYT ANWAEKADGT RDFDMAMAKV EKALQDAGAT       120
     KPEQRTARFI SVLCLAWPDG HTELFRGEVE GSVVWPPRGT QGFGYDPVFQ PEGYDITFGE       180
     MSGEEKHGWN VGKPQALSHR ARAFKLFVET CLEA                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page