(data stored in ACNUC7421 zone)

EMBL: CP001622.PE40

CP001622.PE40        Location/Qualifiers
FT   CDS             complement(36507..37127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0041"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mes:Meso_3334
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54352"
FT                   /db_xref="GOA:C6AYC8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54352.1"
FT                   /translation="MVTKCQSVQMTQNDRKIAQILDAALPVFVRFGFRKTSMADIARAA
FT                   GISRASLYLSFNSKEELFRAGSMRAHTLALDEVGAALAGQGNALDRMEMAIAVFQRELI
FT                   APFGGSSDAEELFAANMALAADITLDARTRLSTMLTQTLNAAAETKEIDLGPLQASPLQ
FT                   LANIMMAAMDGIKHAQWNGSSLDDDTKLFMRLLRVAVTPRSGQ"
     MVTKCQSVQM TQNDRKIAQI LDAALPVFVR FGFRKTSMAD IARAAGISRA SLYLSFNSKE        60
     ELFRAGSMRA HTLALDEVGA ALAGQGNALD RMEMAIAVFQ RELIAPFGGS SDAEELFAAN       120
     MALAADITLD ARTRLSTMLT QTLNAAAETK EIDLGPLQAS PLQLANIMMA AMDGIKHAQW       180
     NGSSLDDDTK LFMRLLRVAV TPRSGQ                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page