(data stored in ACNUC7421 zone)

EMBL: CP001622.PE400

CP001622.PE400       Location/Qualifiers
FT   CDS             413858..415705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0401"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: ret:RHE_CH00709 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54712"
FT                   /db_xref="GOA:C6B1J3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54712.1"
FT                   /translation="MLRLFSTSIVRQIVAITLFLLAISTAAIVGVTYYNLSHQVMDGAV
FT                   SDANDAARAMAVLYGAADQAAKIELKDNQLFAVTEDAIPALADHSLVDRTAQSIAGVAT
FT                   IFQKQGGDYVRISTNVKKENGDRAVGTKLIAEHPAQPVLARGEAYYGPAELFGRKFMTG
FT                   YFPMKNASNANVGILFIGIPMEVYYQRMYELQMLVLGVGAIVMLIVGVLAFYAIRLSVK
FT                   PLQALTASVHSISAGDLEGAIPCVEKKNEFGDIGRALALFSDSARARRDLETQAAEQRE
FT                   LSDAERARNDADKRSLDGQIDFAVNQLAAGLGRLSQGDVSQTIGTPFVGRLEQLRVDFN
FT                   ASLLRLQDTLSGIRDSASTIQRNSGAVSVSAGELSKRTEAQAANLEETAAAVEEITVTV
FT                   RSSAERAREANNVVAATKKTADSSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQT
FT                   NLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSEL
FT                   VQKTGSVLASISQEIIAISGHVETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAE
FT                   TTQASRLLAGEADTLMALIERFRIVAESAPAHLGARRVA"
     MLRLFSTSIV RQIVAITLFL LAISTAAIVG VTYYNLSHQV MDGAVSDAND AARAMAVLYG        60
     AADQAAKIEL KDNQLFAVTE DAIPALADHS LVDRTAQSIA GVATIFQKQG GDYVRISTNV       120
     KKENGDRAVG TKLIAEHPAQ PVLARGEAYY GPAELFGRKF MTGYFPMKNA SNANVGILFI       180
     GIPMEVYYQR MYELQMLVLG VGAIVMLIVG VLAFYAIRLS VKPLQALTAS VHSISAGDLE       240
     GAIPCVEKKN EFGDIGRALA LFSDSARARR DLETQAAEQR ELSDAERARN DADKRSLDGQ       300
     IDFAVNQLAA GLGRLSQGDV SQTIGTPFVG RLEQLRVDFN ASLLRLQDTL SGIRDSASTI       360
     QRNSGAVSVS AGELSKRTEA QAANLEETAA AVEEITVTVR SSAERAREAN NVVAATKKTA       420
     DSSGAVVGDA VAAMDRIEQA SQRIEQIIEV IDDIAFQTNL LALNAGIEAA RAGEAGKGFA       480
     VVAQEVRELA QRSADAAREI KSLIETSSRE VTAGSELVQK TGSVLASISQ EIIAISGHVE       540
     TIATASRDQS AALQEVNGSV NAMDQMTQKN AAMVAETTQA SRLLAGEADT LMALIERFRI       600
     VAESAPAHLG ARRVA                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page