(data stored in ACNUC7421 zone)

EMBL: CP001622.PE402

CP001622.PE402       Location/Qualifiers
FT   CDS             416005..416874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0403"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG:
FT                   rec:RHECIAT_CH0000793 probable transcriptional regulator
FT                   protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54714"
FT                   /db_xref="GOA:C6B1J5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J5"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS54714.1"
FT                   /translation="MKNASWDSYQLFLQVARLGGLTGASTASGLSPATVGRRMLDLEQE
FT                   IGRALFSRSQTGYRLTQDGQALLDHLQEMEAAARKVAAWRQSGEGGTTVRVAAGTWLAW
FT                   LLTENFAAIRMPGDAFAISLTIGEARASLAYRESDIGIRAFEPEEANLAARLLGEVAYA
FT                   VYIRRNAAETDERWIAVAEEEAISAYLRWPHAHAATGIVATVNRPRSLPDLVRAGAGKT
FT                   VLPCFVGDLHPELQRQGGELPELRHRQWIVMNAEDRHRPEIRMVADRMTKLIKSYADLF
FT                   AGKRPSRG"
     MKNASWDSYQ LFLQVARLGG LTGASTASGL SPATVGRRML DLEQEIGRAL FSRSQTGYRL        60
     TQDGQALLDH LQEMEAAARK VAAWRQSGEG GTTVRVAAGT WLAWLLTENF AAIRMPGDAF       120
     AISLTIGEAR ASLAYRESDI GIRAFEPEEA NLAARLLGEV AYAVYIRRNA AETDERWIAV       180
     AEEEAISAYL RWPHAHAATG IVATVNRPRS LPDLVRAGAG KTVLPCFVGD LHPELQRQGG       240
     ELPELRHRQW IVMNAEDRHR PEIRMVADRM TKLIKSYADL FAGKRPSRG                   289
//

If you have problems or comments...

PBIL Back to PBIL home page