(data stored in ACNUC7421 zone)

EMBL: CP001622.PE404

CP001622.PE404       Location/Qualifiers
FT   CDS             complement(417271..418560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0405"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: ret:RHE_CH00712 isocitrate
FT                   lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54716"
FT                   /db_xref="GOA:C6B1J7"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J7"
FT                   /inference="protein motif:TFAM:TIGR01346"
FT                   /protein_id="ACS54716.1"
FT                   /translation="MTDFYKLVPNALADRFDGIERPYSAEDVQRLRGSVALSHTLAAMG
FT                   ADRLWQLLHQEDFVNALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSL
FT                   YPANAGPELAKRINRTLQRADQIETAEAQGLSVETWFAPIVADAEAGFGGPLNAFEIMK
FT                   AYIEAGAAGVHFEDQLASEKKCGHLGGKVLIPTAAHIRNLDAARLAADVMGVATLVIAR
FT                   TDAEAAKLLTSDIDERDQPFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPHCDLIWCE
FT                   TSKPDLDQARRFAEGVHKVHPGKLLAYNCSPSFNWKKNLDEATIARFQRELGAMGYKFQ
FT                   FITLAGFHQLNYGMYELARGYRQRQMSAYSELQQAEFAAEVNGYTATKHQREVGTGYFD
FT                   AVSLAITGGRSSTTAMHGSTEHAQFKPAAE"
     MTDFYKLVPN ALADRFDGIE RPYSAEDVQR LRGSVALSHT LAAMGADRLW QLLHQEDFVN        60
     ALGALSGNQA MQMVRAGLKA IYLSGWQVAA DANTASAMYP DQSLYPANAG PELAKRINRT       120
     LQRADQIETA EAQGLSVETW FAPIVADAEA GFGGPLNAFE IMKAYIEAGA AGVHFEDQLA       180
     SEKKCGHLGG KVLIPTAAHI RNLDAARLAA DVMGVATLVI ARTDAEAAKL LTSDIDERDQ       240
     PFVDYDAGRT VEGFYQVRNG IEPCIARAVA YAPHCDLIWC ETSKPDLDQA RRFAEGVHKV       300
     HPGKLLAYNC SPSFNWKKNL DEATIARFQR ELGAMGYKFQ FITLAGFHQL NYGMYELARG       360
     YRQRQMSAYS ELQQAEFAAE VNGYTATKHQ REVGTGYFDA VSLAITGGRS STTAMHGSTE       420
     HAQFKPAAE                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page