(data stored in ACNUC7421 zone)

EMBL: CP001622.PE405

CP001622.PE405       Location/Qualifiers
FT   CDS             418751..420160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0406"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: protein of unknown function DUF955;
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; KEGG: rec:RHECIAT_CH0000796 probable
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54717"
FT                   /db_xref="GOA:C6B1J8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J8"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ACS54717.1"
FT                   /translation="MAERKIFAGPKVRRIRNALALTQTAMAEALEISPSYLNLIERNQR
FT                   PLTVQLLLKLASVYRVDLEELRGQTGGSLGQLKEVFADPLLSGELPGDQELVEVAEAAP
FT                   NAASGMIKLYRAYREQAARLSDLTVLMAAEGHAPVAAGRLPLDEVRETLERRSGYFARI
FT                   ETAAEAFAATLPGGLDLAAGLKDWLRSERGIAVRVLPVHVMPDLRRRFDRHSMRLFISE
FT                   RLSQADRAHEIAVEAATLALLPAIDAELDDLSLSSAEARRIARFELARIAALALAMPYE
FT                   AFLSAAKATRYDIDILRARFGVSFGQAAARLAMLQRPGAAAIPFFLIEIDAAGHRLRRA
FT                   GAQGFPQARFGGGCPKLNLHAAFLQPGQILAETVVMPDGASFLTVARTLEGPSVEFGER
FT                   VRRTAILIGCDAALGEGVVYGQAMALEPVAVGPACRLCERRGCLSRAEPPVTRPLGLDE
FT                   MVAGLSAFDFQ"
     MAERKIFAGP KVRRIRNALA LTQTAMAEAL EISPSYLNLI ERNQRPLTVQ LLLKLASVYR        60
     VDLEELRGQT GGSLGQLKEV FADPLLSGEL PGDQELVEVA EAAPNAASGM IKLYRAYREQ       120
     AARLSDLTVL MAAEGHAPVA AGRLPLDEVR ETLERRSGYF ARIETAAEAF AATLPGGLDL       180
     AAGLKDWLRS ERGIAVRVLP VHVMPDLRRR FDRHSMRLFI SERLSQADRA HEIAVEAATL       240
     ALLPAIDAEL DDLSLSSAEA RRIARFELAR IAALALAMPY EAFLSAAKAT RYDIDILRAR       300
     FGVSFGQAAA RLAMLQRPGA AAIPFFLIEI DAAGHRLRRA GAQGFPQARF GGGCPKLNLH       360
     AAFLQPGQIL AETVVMPDGA SFLTVARTLE GPSVEFGERV RRTAILIGCD AALGEGVVYG       420
     QAMALEPVAV GPACRLCERR GCLSRAEPPV TRPLGLDEMV AGLSAFDFQ                   469
//

If you have problems or comments...

PBIL Back to PBIL home page