(data stored in ACNUC7421 zone)

EMBL: CP001622.PE406

CP001622.PE406       Location/Qualifiers
FT   CDS             420287..421384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0407"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sme:SMc00770 putrescine-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54718"
FT                   /db_xref="GOA:C6B1J9"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS54718.1"
FT                   /translation="MRSTILCVTAAAVTALLAAAPALAQERVVNVYNWSDYIDSSILED
FT                   FTKETGIKVVYDTFDSNETLETKLLAGGSGYDVVVPTVSFMKRQIAAGVYQKLDKSKLP
FT                   NLVNMWDVIMKGVASFDPGNEYSVDYMWGTTGIGYNVDKVKAALGTDEKPNWDALFDPA
FT                   KAAKLKDCGIYMLDSPTDVVPSVLAYLGLNPNSTDAADLKKAQAVLTAVRPFVRKFHSS
FT                   EYISALANGDICIALGYSGDMFQARDRAKEANVGVKVDYSVPSQGAQIFFDVFGIPKDA
FT                   PHVAEAHEFINYMMKPEVVAKASNVVFYANGNKASQQFLDKEVLDDTAIYPTPEVMAKL
FT                   FTVPPLDPKAQRLVTRLWTTVVTGQ"
     MRSTILCVTA AAVTALLAAA PALAQERVVN VYNWSDYIDS SILEDFTKET GIKVVYDTFD        60
     SNETLETKLL AGGSGYDVVV PTVSFMKRQI AAGVYQKLDK SKLPNLVNMW DVIMKGVASF       120
     DPGNEYSVDY MWGTTGIGYN VDKVKAALGT DEKPNWDALF DPAKAAKLKD CGIYMLDSPT       180
     DVVPSVLAYL GLNPNSTDAA DLKKAQAVLT AVRPFVRKFH SSEYISALAN GDICIALGYS       240
     GDMFQARDRA KEANVGVKVD YSVPSQGAQI FFDVFGIPKD APHVAEAHEF INYMMKPEVV       300
     AKASNVVFYA NGNKASQQFL DKEVLDDTAI YPTPEVMAKL FTVPPLDPKA QRLVTRLWTT       360
     VVTGQ                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page