(data stored in ACNUC7421 zone)

EMBL: CP001622.PE407

CP001622.PE407       Location/Qualifiers
FT   CDS             421498..422640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0408"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000798 spermidine/putrescine
FT                   ABC transporter, ATP-binding protein; TIGRFAM:
FT                   spermidine/putrescine ABC transporter ATPase subunit; PFAM:
FT                   ABC transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54719"
FT                   /db_xref="GOA:C6B1K0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K0"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ACS54719.1"
FT                   /translation="MKSLGNIRRSFAPWTDPSAKPFISIKNVTKRFGDFTAVDNLSLDI
FT                   YHREFFALLGASGCGKSTLLRMLAGFEQPTSGEIVLDGTDMAGTPPYRRPVNMMFQSYA
FT                   LFPHMTVEKNIAFGLRQDGMAKDEMTDRVLQMLKLVKLEQFASRKPNQLSGGQRQRVAL
FT                   ARSLAKRPKVLLLDEPLGALDKKLREETQFELMDLQQNLGLTFVVVTHDQEEAMTMADR
FT                   IAVMSHGKVVQVATPAEIYEAPNCRFVADFIGDVNIFDGKVASSGNGTVEISVDSGFSV
FT                   RVAAAETPSAGSAVGFAIRPEKMRVGRTPPANASVNAARGELWDIAYLGDMTVFHVKLQ
FT                   SGNVVKASSLNAQRSVDDPFTYDQEVWVSFDENAGVLLKD"
     MKSLGNIRRS FAPWTDPSAK PFISIKNVTK RFGDFTAVDN LSLDIYHREF FALLGASGCG        60
     KSTLLRMLAG FEQPTSGEIV LDGTDMAGTP PYRRPVNMMF QSYALFPHMT VEKNIAFGLR       120
     QDGMAKDEMT DRVLQMLKLV KLEQFASRKP NQLSGGQRQR VALARSLAKR PKVLLLDEPL       180
     GALDKKLREE TQFELMDLQQ NLGLTFVVVT HDQEEAMTMA DRIAVMSHGK VVQVATPAEI       240
     YEAPNCRFVA DFIGDVNIFD GKVASSGNGT VEISVDSGFS VRVAAAETPS AGSAVGFAIR       300
     PEKMRVGRTP PANASVNAAR GELWDIAYLG DMTVFHVKLQ SGNVVKASSL NAQRSVDDPF       360
     TYDQEVWVSF DENAGVLLKD                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page