(data stored in ACNUC7421 zone)

EMBL: CP001622.PE408

CP001622.PE408       Location/Qualifiers
FT   CDS             422645..423556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0409"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_CH00716
FT                   spermidine/putrescine ABC transporter, permease component I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54720"
FT                   /db_xref="GOA:C6B1K1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54720.1"
FT                   /translation="MGKFTSGLYNRLVIVIPYAWLLLFFLAPFFIVFRISLSTTAIAMP
FT                   PYEPVFSFADGWAGLLSKIGEFSFDNYTYLTDDPLYFNAYVSSVVIAGISTFLTLLIAY
FT                   PIAYGMAQAPRGLRPTLVMLVILPFWTSFLIRVYAWIAILKPEGLFNQLLLSLHLIDTP
FT                   LIILNTNTAVYIGIVYSYLPFMVLPLYSALEKMDGTLIEAAQDLGCPPITAFWRITFPL
FT                   SIPGVVAGCMLVFIPAVGEFVIPDLLGGSQTLMIGKTLWNEFNSNRDWPVSSAVATILL
FT                   LILVIPIVFFQNVQAKAEERGK"
     MGKFTSGLYN RLVIVIPYAW LLLFFLAPFF IVFRISLSTT AIAMPPYEPV FSFADGWAGL        60
     LSKIGEFSFD NYTYLTDDPL YFNAYVSSVV IAGISTFLTL LIAYPIAYGM AQAPRGLRPT       120
     LVMLVILPFW TSFLIRVYAW IAILKPEGLF NQLLLSLHLI DTPLIILNTN TAVYIGIVYS       180
     YLPFMVLPLY SALEKMDGTL IEAAQDLGCP PITAFWRITF PLSIPGVVAG CMLVFIPAVG       240
     EFVIPDLLGG SQTLMIGKTL WNEFNSNRDW PVSSAVATIL LLILVIPIVF FQNVQAKAEE       300
     RGK                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page