(data stored in ACNUC7421 zone)

EMBL: CP001622.PE409

CP001622.PE409       Location/Qualifiers
FT   CDS             423560..424378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0410"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000800
FT                   spermidine/putrescine ABC transporter, permease component
FT                   II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54721"
FT                   /db_xref="GOA:C6B1K2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54721.1"
FT                   /translation="MLKWTRFNIVSVTLGFAFLYLPIVLLVIFSFNESKLVTVWGGFST
FT                   KWYVSLMSNQALLDAAWVTLRVGLLSATFATILGTMAALTLVRYTRFRGRMLFSGMVYA
FT                   PLVMPEVITGLSLLLLFVAIGLDRGFWTITLAHTTLTMCFVAVVVQSRLLSFDHSIEEA
FT                   AQDLGAPPVRTFFEITLPIIAPAVASGWILAFTLSLDDLVIASFTSGPGATTLPMRIYS
FT                   QVRLGVTPEINAVCTILIGIVALGVICASIITKRRETQRQRDERAAAAGA"
     MLKWTRFNIV SVTLGFAFLY LPIVLLVIFS FNESKLVTVW GGFSTKWYVS LMSNQALLDA        60
     AWVTLRVGLL SATFATILGT MAALTLVRYT RFRGRMLFSG MVYAPLVMPE VITGLSLLLL       120
     FVAIGLDRGF WTITLAHTTL TMCFVAVVVQ SRLLSFDHSI EEAAQDLGAP PVRTFFEITL       180
     PIIAPAVASG WILAFTLSLD DLVIASFTSG PGATTLPMRI YSQVRLGVTP EINAVCTILI       240
     GIVALGVICA SIITKRRETQ RQRDERAAAA GA                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page