(data stored in ACNUC7421 zone)

EMBL: CP001622.PE41

CP001622.PE41        Location/Qualifiers
FT   CDS             37209..38207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0042"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; short-chain dehydrogenase/reductase SDR; KEGG:
FT                   hne:HNE_3360 NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54353"
FT                   /db_xref="GOA:C6AYC9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54353.1"
FT                   /translation="MSITSDNSNGATVLVTGIGGFLAGHIALQLLKQGYRVRGSLRSIG
FT                   TSAATVGQLGAHTDGQLQNLGLVQADLDSDSGWAAAVEGCDYVIHTASPFPPGYPENEN
FT                   ALIQTARDGALRVLREAHRARVKRVVLTSSIAATNHGDGRAPFTEENWTDPESPRATPY
FT                   YKSKTLDLAVINPSVILGPLLGPNFGTSVGLIHHLMTGRFNGIPRFGFSVVDVRDTADA
FT                   HIRAMTDPAAGGQRFIIGGRFFWLKDLVAILAHSFPDHASRLPSGEVSDEIVRVMAQSD
FT                   PDARTIVHELNRDLSVSAAKAHRVLGWRSRPEEQCIRASAQSLIDLGLVPA"
     MSITSDNSNG ATVLVTGIGG FLAGHIALQL LKQGYRVRGS LRSIGTSAAT VGQLGAHTDG        60
     QLQNLGLVQA DLDSDSGWAA AVEGCDYVIH TASPFPPGYP ENENALIQTA RDGALRVLRE       120
     AHRARVKRVV LTSSIAATNH GDGRAPFTEE NWTDPESPRA TPYYKSKTLD LAVINPSVIL       180
     GPLLGPNFGT SVGLIHHLMT GRFNGIPRFG FSVVDVRDTA DAHIRAMTDP AAGGQRFIIG       240
     GRFFWLKDLV AILAHSFPDH ASRLPSGEVS DEIVRVMAQS DPDARTIVHE LNRDLSVSAA       300
     KAHRVLGWRS RPEEQCIRAS AQSLIDLGLV PA                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page