(data stored in ACNUC7421 zone)

EMBL: CP001622.PE410

CP001622.PE410       Location/Qualifiers
FT   CDS             complement(424468..426360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0411"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: ret:RHE_CH00718
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54722"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K3"
FT                   /inference="protein motif:PFAM:PF05170"
FT                   /protein_id="ACS54722.1"
FT                   /translation="MSTSRHRRWRRKIGPVSRWLPAFARLSTVFLLIALALFVALRVAA
FT                   PYLISTGFVRSGIEDALSKWTGYHAEIKGSPVLEFWPTPRITLNQITIRQPRESGDKLL
FT                   GSIESLSADFSLIDALRGRTSFHEFHLVRPNLALTRDEKGLIDWSYAGLLARAISGVRY
FT                   ENGAEVLDPDLDAEIGAVTVEDGTLVVTDIKSAKTYHFDSVTADIAWPRLSGAISSVVI
FT                   ARINGQDLKVDFASRQPLLAFAGRNAETRTSLTSNLLTAHFQGIASIANLSALSGNVTA
FT                   TIPDVPALLTWSGKSIPGIATLKSASLESDIMSSGNGLRFNNLSLSLNEASATGVMDLF
FT                   TQPGKRPKIGGTLAFDQMNLKPFLDAFALRLAAGEAEEISAGISGPLRLLDIDVRLSAR
FT                   RAQMGLFELSDVGASVIVAGGEAKFDIGDSQFEGGEMTAHLEATQRDFDGGGKLRLSIR
FT                   DADFAALAERLQLKGPLPLATGSIDLDLQSPKAIWTTGLADVTGKLHFWTGEGTIPGID
FT                   ATALRTQAAEKPFFPLSAAAGGAFAFSQLNLQADFANGSAEIHDAHIAGPTQTLTLSGI
FT                   ITYHSNGLALSGSLDATDPAKAAELPLLPFFIGGSWPNPVISPVPLFGNTPHAQ"
     MSTSRHRRWR RKIGPVSRWL PAFARLSTVF LLIALALFVA LRVAAPYLIS TGFVRSGIED        60
     ALSKWTGYHA EIKGSPVLEF WPTPRITLNQ ITIRQPRESG DKLLGSIESL SADFSLIDAL       120
     RGRTSFHEFH LVRPNLALTR DEKGLIDWSY AGLLARAISG VRYENGAEVL DPDLDAEIGA       180
     VTVEDGTLVV TDIKSAKTYH FDSVTADIAW PRLSGAISSV VIARINGQDL KVDFASRQPL       240
     LAFAGRNAET RTSLTSNLLT AHFQGIASIA NLSALSGNVT ATIPDVPALL TWSGKSIPGI       300
     ATLKSASLES DIMSSGNGLR FNNLSLSLNE ASATGVMDLF TQPGKRPKIG GTLAFDQMNL       360
     KPFLDAFALR LAAGEAEEIS AGISGPLRLL DIDVRLSARR AQMGLFELSD VGASVIVAGG       420
     EAKFDIGDSQ FEGGEMTAHL EATQRDFDGG GKLRLSIRDA DFAALAERLQ LKGPLPLATG       480
     SIDLDLQSPK AIWTTGLADV TGKLHFWTGE GTIPGIDATA LRTQAAEKPF FPLSAAAGGA       540
     FAFSQLNLQA DFANGSAEIH DAHIAGPTQT LTLSGIITYH SNGLALSGSL DATDPAKAAE       600
     LPLLPFFIGG SWPNPVISPV PLFGNTPHAQ                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page