(data stored in ACNUC7421 zone)

EMBL: CP001622.PE411

CP001622.PE411       Location/Qualifiers
FT   CDS             426636..428588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0412"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG:
FT                   rec:RHECIAT_CH0000803 acetyl-CoA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54723"
FT                   /db_xref="GOA:C6B1K4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K4"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACS54723.1"
FT                   /translation="MQDNRPLWVPSEDAIAKSPIHAFMERCNADFGLSLSGFEDLHAWS
FT                   VAERENFWSAVWDFCGVQGERGAEVLANGDRMLEARFFPDATLNFAENLLSGRGDGDAI
FT                   IFRGEDKAEDRWSWDRLRALVSKLQQAFVARGIGKGDRVAAMMPNMPETVAAMLAAASI
FT                   GAIWSSCSPDFGEQGVLDRFGQIEPRLFIACDAYWYSGKLQDVGAKVATVAKTLAIPTV
FT                   IVHYAGNAEAVARKTPGALTLEAFVAPYEAREVEFTRLAFAHPLYILFSSGTTGVPKCI
FT                   VHSAGGTLLQHLKEQRLHCGLQAGEKLFYFTTCGWMMWNWLVSGLASGATLCLFDGSPF
FT                   APDGNVLFDYAEAEKFVIFGTSAKYIDAVRKGGLTPRVSHDLSSLRLMTSTGSPLSPEG
FT                   FTFVYEGIKKDVQLASISGGTDIVSCFVLGNPLQPVWRGEIQGAGLGLAVDVWNDDGKP
FT                   VRGEKGELVCTKAFPSMPVMFWNDPDGAKYRAAYFDRFDNVWCHGDFAEWTEHGGLVIH
FT                   GRSDATLNPGGVRIGTAEIYNQVEQMAEVAEALCIGQDWDDDVRVILFVRLAPDVKLTE
FT                   DLVKAIKSRIRTGASPRHVPAKIIAVADIPRTKSGKIVELAVREVVHGRPVKNQEALAN
FT                   PEALGLFAGLSELRD"
     MQDNRPLWVP SEDAIAKSPI HAFMERCNAD FGLSLSGFED LHAWSVAERE NFWSAVWDFC        60
     GVQGERGAEV LANGDRMLEA RFFPDATLNF AENLLSGRGD GDAIIFRGED KAEDRWSWDR       120
     LRALVSKLQQ AFVARGIGKG DRVAAMMPNM PETVAAMLAA ASIGAIWSSC SPDFGEQGVL       180
     DRFGQIEPRL FIACDAYWYS GKLQDVGAKV ATVAKTLAIP TVIVHYAGNA EAVARKTPGA       240
     LTLEAFVAPY EAREVEFTRL AFAHPLYILF SSGTTGVPKC IVHSAGGTLL QHLKEQRLHC       300
     GLQAGEKLFY FTTCGWMMWN WLVSGLASGA TLCLFDGSPF APDGNVLFDY AEAEKFVIFG       360
     TSAKYIDAVR KGGLTPRVSH DLSSLRLMTS TGSPLSPEGF TFVYEGIKKD VQLASISGGT       420
     DIVSCFVLGN PLQPVWRGEI QGAGLGLAVD VWNDDGKPVR GEKGELVCTK AFPSMPVMFW       480
     NDPDGAKYRA AYFDRFDNVW CHGDFAEWTE HGGLVIHGRS DATLNPGGVR IGTAEIYNQV       540
     EQMAEVAEAL CIGQDWDDDV RVILFVRLAP DVKLTEDLVK AIKSRIRTGA SPRHVPAKII       600
     AVADIPRTKS GKIVELAVRE VVHGRPVKNQ EALANPEALG LFAGLSELRD                  650
//

If you have problems or comments...

PBIL Back to PBIL home page