(data stored in ACNUC7421 zone)

EMBL: CP001622.PE412

CP001622.PE412       Location/Qualifiers
FT   CDS             complement(428804..432634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0413"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rec:RHECIAT_CH0000804 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   PAS fold domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54724"
FT                   /db_xref="GOA:C6B1K5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS54724.1"
FT                   /translation="MPAVQYPFIDIAVHARVRERFSRGEAMVLFSADLARLLWANGAGA
FT                   ELFGHSAVYDLLDQGVDRADITFRQLETAARQLTDIGDSRSLMIRVAKGFQRAQVQAAA
FT                   ELIRLSQGEQAILFSVPVSAKPLAAGASAAQMLQGLDDPDTHMAVIGANGEVIAASPGF
FT                   ASLGISEQTAKTLINLAGAHPDRLVKRPVATGRGNLPAAVGKLSDDPALNLLFAVETAV
FT                   GHLDPVDAPALAPVDAPALDPVDAPAQEESAPPMEVLQDEPVAATGFTEIIDAVSGIEE
FT                   VEETLEEITGENEQPAEIAVASADEAIDGMDPAEDAEPKSDDGVTDSSADEPAAVIEDD
FT                   VTSIAETAEPPVEASETPIEDAPEAVHEETAIATPVVPDVPPAPQLEAESGFVFRPNSR
FT                   ATRFVWKIDAEGRFNEVSHEFAAAVGPHASDIIGSAFGDVAALFNLDPDGKLSEALARR
FT                   DTWSGKTILWPVEGTSLVVPVDLAALPTYTRNRDFDGFRGFGVVRLSDAQEDPLALGLT
FT                   LGPDGIGHDAASLGPPAETIAEVAHEAETVLEEPLIDPSPTQEVEDQALTASEPQAEPA
FT                   PEEIATEQAAEIPAQESAAEKAEGSADAGDISAAEPVAELPQEPPALRISETPNRRFSD
FT                   KIVQLHNTGAGLTAAEQANFREIAKRLEAFGANKDEPAAPAPMEPNATETAAFNEASGP
FT                   EAFGAETPTADQADIPSLEEIAPQEAIFENAVEAEREDDGATEEPAVIVEDEATEGLEE
FT                   TASQIEVLTSFIPPRIKMTDGLSVGTVDQLPVAVLIHIGDALIHANPEFMRLTGYGSLD
FT                   ALREVGGIEGLLQRRELEEKAAGSGTMMLVKADDTLAPVTARLQSVRWEDANALMLALM
FT                   PVEGKEDGRGDANRFDGRSEDRPERMVEKVAKLQVEVEELRSILETATDGVVVIGTEGD
FT                   IRSMNRSASALFNYDEQETRGKPFVMLFAHESQKAVIDYLNGLSGHGVASVLNDGREVI
FT                   GREAAGGFVPLFMTMGQLTSSNGYCAVIRDITQWKRTEDELRNAKGAAETANAHKTDFL
FT                   ARVSHEIRTPLNAIIGFSDMMAGERFGPIGHPRYIEYANDIGRSGRHVLDIVNDLLDIS
FT                   KIEAGEMDLDFAAVGLNEAVSEAVALVQPQANGQRVIIRTALSQAVPEVVADLRSIKQI
FT                   ALNILSNAIRFTPSGGQIVVSTSYEANGSVVLRVRDTGIGMTRSELDQAMKPFRQVSST
FT                   QSRHRGDGTGLGLPLTKAMVDANRATFTINSAPNEGTLVEITFPSQRVLAG"
     MPAVQYPFID IAVHARVRER FSRGEAMVLF SADLARLLWA NGAGAELFGH SAVYDLLDQG        60
     VDRADITFRQ LETAARQLTD IGDSRSLMIR VAKGFQRAQV QAAAELIRLS QGEQAILFSV       120
     PVSAKPLAAG ASAAQMLQGL DDPDTHMAVI GANGEVIAAS PGFASLGISE QTAKTLINLA       180
     GAHPDRLVKR PVATGRGNLP AAVGKLSDDP ALNLLFAVET AVGHLDPVDA PALAPVDAPA       240
     LDPVDAPAQE ESAPPMEVLQ DEPVAATGFT EIIDAVSGIE EVEETLEEIT GENEQPAEIA       300
     VASADEAIDG MDPAEDAEPK SDDGVTDSSA DEPAAVIEDD VTSIAETAEP PVEASETPIE       360
     DAPEAVHEET AIATPVVPDV PPAPQLEAES GFVFRPNSRA TRFVWKIDAE GRFNEVSHEF       420
     AAAVGPHASD IIGSAFGDVA ALFNLDPDGK LSEALARRDT WSGKTILWPV EGTSLVVPVD       480
     LAALPTYTRN RDFDGFRGFG VVRLSDAQED PLALGLTLGP DGIGHDAASL GPPAETIAEV       540
     AHEAETVLEE PLIDPSPTQE VEDQALTASE PQAEPAPEEI ATEQAAEIPA QESAAEKAEG       600
     SADAGDISAA EPVAELPQEP PALRISETPN RRFSDKIVQL HNTGAGLTAA EQANFREIAK       660
     RLEAFGANKD EPAAPAPMEP NATETAAFNE ASGPEAFGAE TPTADQADIP SLEEIAPQEA       720
     IFENAVEAER EDDGATEEPA VIVEDEATEG LEETASQIEV LTSFIPPRIK MTDGLSVGTV       780
     DQLPVAVLIH IGDALIHANP EFMRLTGYGS LDALREVGGI EGLLQRRELE EKAAGSGTMM       840
     LVKADDTLAP VTARLQSVRW EDANALMLAL MPVEGKEDGR GDANRFDGRS EDRPERMVEK       900
     VAKLQVEVEE LRSILETATD GVVVIGTEGD IRSMNRSASA LFNYDEQETR GKPFVMLFAH       960
     ESQKAVIDYL NGLSGHGVAS VLNDGREVIG REAAGGFVPL FMTMGQLTSS NGYCAVIRDI      1020
     TQWKRTEDEL RNAKGAAETA NAHKTDFLAR VSHEIRTPLN AIIGFSDMMA GERFGPIGHP      1080
     RYIEYANDIG RSGRHVLDIV NDLLDISKIE AGEMDLDFAA VGLNEAVSEA VALVQPQANG      1140
     QRVIIRTALS QAVPEVVADL RSIKQIALNI LSNAIRFTPS GGQIVVSTSY EANGSVVLRV      1200
     RDTGIGMTRS ELDQAMKPFR QVSSTQSRHR GDGTGLGLPL TKAMVDANRA TFTINSAPNE      1260
     GTLVEITFPS QRVLAG                                                      1276
//

If you have problems or comments...

PBIL Back to PBIL home page