(data stored in ACNUC7421 zone)

EMBL: CP001622.PE413

CP001622.PE413       Location/Qualifiers
FT   CDS             432848..433297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0414"
FT                   /product="phasin"
FT                   /note="TIGRFAM: phasin; KEGG: ret:RHE_CH00721 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54725"
FT                   /db_xref="InterPro:IPR010234"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K6"
FT                   /inference="protein motif:TFAM:TIGR01985"
FT                   /protein_id="ACS54725.1"
FT                   /translation="MATIKTDDVFSIASFDPSKFTESFREFAEKGAQQSKDAYAKLKTA
FT                   GEEAGKTLEATVQTAQAGSVEIGLKAIDILRINSENSLSHFEALLGVKSPAEFFELQTS
FT                   FIRKQAELTVEQAKSIQETTKQVAEKLAKPSKDAAEKAMASFKVA"
     MATIKTDDVF SIASFDPSKF TESFREFAEK GAQQSKDAYA KLKTAGEEAG KTLEATVQTA        60
     QAGSVEIGLK AIDILRINSE NSLSHFEALL GVKSPAEFFE LQTSFIRKQA ELTVEQAKSI       120
     QETTKQVAEK LAKPSKDAAE KAMASFKVA                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page