(data stored in ACNUC7421 zone)

EMBL: CP001622.PE414

CP001622.PE414       Location/Qualifiers
FT   CDS             433597..434040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54726"
FT                   /db_xref="InterPro:IPR025232"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K7"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00727"
FT                   /protein_id="ACS54726.1"
FT                   /translation="MSKTLLYGATKIDETNSAYAPMESLAAFQWKNRVFILFADRDNSR
FT                   ASRQENQLLADRSALDDRHLVVLKISGAGVRPLFGAADGLDGEAIRRDLEAPEVGEFAA
FT                   FLLGKDGTVKLEISEPITDGELFAIIDSMPMRAAESLKPDKSS"
     MSKTLLYGAT KIDETNSAYA PMESLAAFQW KNRVFILFAD RDNSRASRQE NQLLADRSAL        60
     DDRHLVVLKI SGAGVRPLFG AADGLDGEAI RRDLEAPEVG EFAAFLLGKD GTVKLEISEP       120
     ITDGELFAII DSMPMRAAES LKPDKSS                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page