(data stored in ACNUC7421 zone)

EMBL: CP001622.PE415

CP001622.PE415       Location/Qualifiers
FT   CDS             434097..434264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54727"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K8"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00728"
FT                   /protein_id="ACS54727.1"
FT                   /translation="MSVPNEPIPDQPPMPAPGWKPVPPIKEPEPDRLPDEAPVPNPDEN
FT                   DEPAKHTFET"
     MSVPNEPIPD QPPMPAPGWK PVPPIKEPEP DRLPDEAPVP NPDENDEPAK HTFET             55
//

If you have problems or comments...

PBIL Back to PBIL home page