(data stored in ACNUC7421 zone)

EMBL: CP001622.PE416

CP001622.PE416       Location/Qualifiers
FT   CDS             complement(434261..435142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0417"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_CH00729 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54728"
FT                   /db_xref="GOA:C6B1K9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54728.1"
FT                   /translation="MNWDDVRIFLAVARTGQILAASKRLGLNHATLSRRLTSLEEALKT
FT                   RLFIRRTNGCELTAEGEVFLASAERMETEMLAAQASLGHTDTAIAGTVRVGAPDGFGVS
FT                   FLAPRMGRLIERHPELKIQLVPVPRSFSLSQREADIAITLERPEQGRLVSSKLTDYTLG
FT                   LYASRAYLAAQGTPADIDALKAHRRIGYVEDLIFTASLNFSGAVMRSWDAGFEISTAIG
FT                   QTEAVRTGAGIGILHDYIARQYPELQRILPEVSIRRAYWTTYHETARDLLRVRSVADFL
FT                   QELVSAERHIFL"
     MNWDDVRIFL AVARTGQILA ASKRLGLNHA TLSRRLTSLE EALKTRLFIR RTNGCELTAE        60
     GEVFLASAER METEMLAAQA SLGHTDTAIA GTVRVGAPDG FGVSFLAPRM GRLIERHPEL       120
     KIQLVPVPRS FSLSQREADI AITLERPEQG RLVSSKLTDY TLGLYASRAY LAAQGTPADI       180
     DALKAHRRIG YVEDLIFTAS LNFSGAVMRS WDAGFEISTA IGQTEAVRTG AGIGILHDYI       240
     ARQYPELQRI LPEVSIRRAY WTTYHETARD LLRVRSVADF LQELVSAERH IFL              293
//

If you have problems or comments...

PBIL Back to PBIL home page