(data stored in ACNUC7421 zone)

EMBL: CP001622.PE417

CP001622.PE417       Location/Qualifiers
FT   CDS             complement(435139..435453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0418"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rec:RHECIAT_CH0000812 putative antibiotic biosynthesis
FT                   monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54729"
FT                   /db_xref="GOA:C6B1L0"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L0"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACS54729.1"
FT                   /translation="MNRKPVVRMAELEIEPDTLETYRALLTEEIEASIALEDGVLSLSA
FT                   VSIRNNPNRIRILEVYADQEAYEAHLRTPHFIKYKNQTAHMVTSLTFIEVDPIAMRAKP
FT                   "
     MNRKPVVRMA ELEIEPDTLE TYRALLTEEI EASIALEDGV LSLSAVSIRN NPNRIRILEV        60
     YADQEAYEAH LRTPHFIKYK NQTAHMVTSL TFIEVDPIAM RAKP                        104
//

If you have problems or comments...

PBIL Back to PBIL home page