(data stored in ACNUC7421 zone)

EMBL: CP001622.PE418

CP001622.PE418       Location/Qualifiers
FT   CDS             435646..437142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0419"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase; KEGG: rec:RHECIAT_CH0000813
FT                   methylmalonate-semialdehyde dehydrogenase (acylating)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54730"
FT                   /db_xref="GOA:C6B1L1"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L1"
FT                   /inference="protein motif:TFAM:TIGR01722"
FT                   /protein_id="ACS54730.1"
FT                   /translation="MREIGHFIGGKHVAGTSGRVSNVYNPATGEVQATVALASVEELRA
FT                   AVENAKAAQPKWAATNPQRRARVFFKFVELLNKHMDELAEILSKEHGKTIEDAKGDVIR
FT                   GLEVCEFVCGIPHLAKGEFTEGAGPAIDMYSIRQPVGIGAGITPFNFPGMIPMWMFAPA
FT                   IACGNAFILKPSERDPSLPIRLGELMIEAGLPAGILNVVNGDKGAVDAILTDPDIGAVS
FT                   FVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDADLDQAVNALMGAGYGSAGERC
FT                   MAISVAVPVGEETANRLVEKLTPKIESLRIGPYTDDKADMGPLVTKEAYTRVRGLIDRG
FT                   IEEGAKLVVDGRDFKLQGYEDGYFVGGCLFDHVTPEMDIYKTEIFGPVLSVVRANNYEE
FT                   ALSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMIGINVPIPVPLAYHSFGGWKASSF
FT                   GDLNQHGTDSIKFWTKTKTVTARWPSGIKSGAEFVMPTMK"
     MREIGHFIGG KHVAGTSGRV SNVYNPATGE VQATVALASV EELRAAVENA KAAQPKWAAT        60
     NPQRRARVFF KFVELLNKHM DELAEILSKE HGKTIEDAKG DVIRGLEVCE FVCGIPHLAK       120
     GEFTEGAGPA IDMYSIRQPV GIGAGITPFN FPGMIPMWMF APAIACGNAF ILKPSERDPS       180
     LPIRLGELMI EAGLPAGILN VVNGDKGAVD AILTDPDIGA VSFVGSTPIA RYVYGTAAMN       240
     GKRAQCFGGA KNHMIIMPDA DLDQAVNALM GAGYGSAGER CMAISVAVPV GEETANRLVE       300
     KLTPKIESLR IGPYTDDKAD MGPLVTKEAY TRVRGLIDRG IEEGAKLVVD GRDFKLQGYE       360
     DGYFVGGCLF DHVTPEMDIY KTEIFGPVLS VVRANNYEEA LSLPMKHEYG NGVAIYTRDG       420
     DAARDFASRI NIGMIGINVP IPVPLAYHSF GGWKASSFGD LNQHGTDSIK FWTKTKTVTA       480
     RWPSGIKSGA EFVMPTMK                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page