(data stored in ACNUC7421 zone)

EMBL: CP001622.PE419

CP001622.PE419       Location/Qualifiers
FT   CDS             437487..437969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0421"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   rec:RHECIAT_CH0000814 rhizobial iron transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54731"
FT                   /db_xref="GOA:C6B1L2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L2"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACS54731.1"
FT                   /translation="MRLTKQTNYAVRMLMYCAANDGHLSRIPEIARAYGVSELFLFKIL
FT                   QPLNKAGLVETVRGRNGGVRLGKPAADISLFDVVRVTEDSFAMAECFEDDGEVDCPLVD
FT                   SCGLNSALRKALNAFFAVLSEYSIDDLVKARPQINFLLGITGEPAYRKPSIVAPAA"
     MRLTKQTNYA VRMLMYCAAN DGHLSRIPEI ARAYGVSELF LFKILQPLNK AGLVETVRGR        60
     NGGVRLGKPA ADISLFDVVR VTEDSFAMAE CFEDDGEVDC PLVDSCGLNS ALRKALNAFF       120
     AVLSEYSIDD LVKARPQINF LLGITGEPAY RKPSIVAPAA                             160
//

If you have problems or comments...

PBIL Back to PBIL home page