(data stored in ACNUC7421 zone)

EMBL: CP001622.PE42

CP001622.PE42        Location/Qualifiers
FT   CDS             38256..38660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A1246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54354"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD0"
FT                   /inference="similar to AA sequence:KEGG:H16_A1246"
FT                   /protein_id="ACS54354.1"
FT                   /translation="MTIPTVDAFSPANEANLLRETEHARLRALINADIVRAQQLHAPDF
FT                   QLITPIGATLSKEEYLGAIASGQINYLIWEPADIAVRLYDGVAVLRYRAQLEVVFGGHK
FT                   VALNDYWHTDTYERHDGRWMVVWSQATAIN"
     MTIPTVDAFS PANEANLLRE TEHARLRALI NADIVRAQQL HAPDFQLITP IGATLSKEEY        60
     LGAIASGQIN YLIWEPADIA VRLYDGVAVL RYRAQLEVVF GGHKVALNDY WHTDTYERHD       120
     GRWMVVWSQA TAIN                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page