(data stored in ACNUC7421 zone)

EMBL: CP001622.PE420

CP001622.PE420       Location/Qualifiers
FT   CDS             438308..439903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0422"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rec:RHECIAT_CH0000815 dipeptide ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54732"
FT                   /db_xref="GOA:C6B1L3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACS54732.1"
FT                   /translation="MKKISVLLAATALISVMATSAWSKTLVYCSEGSPEGFDPSLYTAG
FT                   TTFDASSRTVYSRLVEFKHGGTEIEPGLADSWSVSADGTEYTFKLHPGVKYQTTDFFTP
FT                   TRDFNADDVVFSFERQLKSDNPWNKYVEGGSYEYAAGMGFPELIKSVEKVDDLTVKFTL
FT                   NHPEAPFLADLAMDFASIVSKEYADKLAADGKMAQLNQQPLGTGPYTFVAYQPDAVIRY
FT                   KANETYFKGKEKIDDLVFAITSDAAVRAQKLKAGECHLIPYPNAADVPELKKDENLTVL
FT                   EQAGLNVGFLAYNTQMAPFDKPEVRRALNMAINKQAIIDAVFQGAAAVAKNPIPPTMWS
FT                   YNDAVQDDKYDPDAAKKALADAGVKDLSMKIWAMPVSRPYMLNARRAAELMQADFAKIG
FT                   VKVEIVTHEWAEYLKLSSDVKRDGAVILGWTGDNGDPDNFMDTLLGCDAVGGNNRAQWC
FT                   NKEYDDLMTKAKLTADVGERTKAYEQAQLIFKKEAPWATIDHSLVFVPMSKKVSGFQMD
FT                   PLGIHRFDGVDVSE"
     MKKISVLLAA TALISVMATS AWSKTLVYCS EGSPEGFDPS LYTAGTTFDA SSRTVYSRLV        60
     EFKHGGTEIE PGLADSWSVS ADGTEYTFKL HPGVKYQTTD FFTPTRDFNA DDVVFSFERQ       120
     LKSDNPWNKY VEGGSYEYAA GMGFPELIKS VEKVDDLTVK FTLNHPEAPF LADLAMDFAS       180
     IVSKEYADKL AADGKMAQLN QQPLGTGPYT FVAYQPDAVI RYKANETYFK GKEKIDDLVF       240
     AITSDAAVRA QKLKAGECHL IPYPNAADVP ELKKDENLTV LEQAGLNVGF LAYNTQMAPF       300
     DKPEVRRALN MAINKQAIID AVFQGAAAVA KNPIPPTMWS YNDAVQDDKY DPDAAKKALA       360
     DAGVKDLSMK IWAMPVSRPY MLNARRAAEL MQADFAKIGV KVEIVTHEWA EYLKLSSDVK       420
     RDGAVILGWT GDNGDPDNFM DTLLGCDAVG GNNRAQWCNK EYDDLMTKAK LTADVGERTK       480
     AYEQAQLIFK KEAPWATIDH SLVFVPMSKK VSGFQMDPLG IHRFDGVDVS E                531
//

If you have problems or comments...

PBIL Back to PBIL home page