(data stored in ACNUC7421 zone)

EMBL: CP001622.PE421

CP001622.PE421       Location/Qualifiers
FT   CDS             439990..440994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0423"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000816
FT                   dipeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54733"
FT                   /db_xref="GOA:C6B1L4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54733.1"
FT                   /translation="MLRFFIGRLAVLIPTFLGVSLIAFSFIRMLPGDPVMLLSGERVMA
FT                   PERHAQIMHDLGFDRPMYVQYFDYLGKILHGDLGTSIVTKRPVLGEFLTLFPATLELSL
FT                   CAIILAVCLGVPAGIFAAVKRGTWFDQSVMGIALIGYSMPIFWWGLLLIIFFSGYLGWT
FT                   PVSGRISLMYFFKPVTGFMLVDSLLSGQKGAFSSAVSYLILPTIVLATIPLAVIARQTR
FT                   SAMLEVLGEDYVRTARSKGLKPLRVVGVHALRNAMIPVITTIGLQIGVLLAGAILTETI
FT                   FSWPGIGKWMVDSVFKRDYAVVQGGLLLIAGVIMLVNLIVDVLYGFINPRIRH"
     MLRFFIGRLA VLIPTFLGVS LIAFSFIRML PGDPVMLLSG ERVMAPERHA QIMHDLGFDR        60
     PMYVQYFDYL GKILHGDLGT SIVTKRPVLG EFLTLFPATL ELSLCAIILA VCLGVPAGIF       120
     AAVKRGTWFD QSVMGIALIG YSMPIFWWGL LLIIFFSGYL GWTPVSGRIS LMYFFKPVTG       180
     FMLVDSLLSG QKGAFSSAVS YLILPTIVLA TIPLAVIARQ TRSAMLEVLG EDYVRTARSK       240
     GLKPLRVVGV HALRNAMIPV ITTIGLQIGV LLAGAILTET IFSWPGIGKW MVDSVFKRDY       300
     AVVQGGLLLI AGVIMLVNLI VDVLYGFINP RIRH                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page