(data stored in ACNUC7421 zone)

EMBL: CP001622.PE422

CP001622.PE422       Location/Qualifiers
FT   CDS             441004..441894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0424"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000817
FT                   dipeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54734"
FT                   /db_xref="GOA:C6B1L5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54734.1"
FT                   /translation="MSTVTVKTGQPSALAEFWHYFSRNKGAVIGLVVFTIILVVAVLAP
FT                   LFAPHEPNEQNRAVLLAVPFWMEGGSASFPLGTDAVGRDILSRLIYGARFSLFIGVVVV
FT                   TLSVISGVLIGLVAGFFRGKVDTAIMRLMDIILAFPSLLLALVLVAVLGPGLTNAMIAI
FT                   SLVNQPHFVRLTRASVISEREKEYVIASRVAGAGTFRLMFKTILPNCLGPLIVQATLAF
FT                   SAAILDAAALGFLGMGAQPPTPEWGTMLAESREFISRAWWVVTFPGLAILITVLAINLM
FT                   GDGLRDALDPKLKRS"
     MSTVTVKTGQ PSALAEFWHY FSRNKGAVIG LVVFTIILVV AVLAPLFAPH EPNEQNRAVL        60
     LAVPFWMEGG SASFPLGTDA VGRDILSRLI YGARFSLFIG VVVVTLSVIS GVLIGLVAGF       120
     FRGKVDTAIM RLMDIILAFP SLLLALVLVA VLGPGLTNAM IAISLVNQPH FVRLTRASVI       180
     SEREKEYVIA SRVAGAGTFR LMFKTILPNC LGPLIVQATL AFSAAILDAA ALGFLGMGAQ       240
     PPTPEWGTML AESREFISRA WWVVTFPGLA ILITVLAINL MGDGLRDALD PKLKRS           296
//

If you have problems or comments...

PBIL Back to PBIL home page