(data stored in ACNUC7421 zone)

EMBL: CP001622.PE423

CP001622.PE423       Location/Qualifiers
FT   CDS             441894..442910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0425"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ret:RHE_CH00739 dipeptide ABC transporter,
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54735"
FT                   /db_xref="GOA:C6B1L6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L6"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS54735.1"
FT                   /translation="MPLLEIENLTVEFQTSSGLFRAVDGVSLACDKGEILSVVGESGSG
FT                   KSVAMLALMGLLPWTAKITADRMQFDGKDLRGISGRQRRRIVGKDMAMIFQEPMSSLNP
FT                   CFTVGFQLGETLRFHMGLNRKERRQRSIELLNLVGIPAPEDRLSNFPHQMSGGMSQRVM
FT                   IAMALACNPKLLIADEPTTALDVTIQAQILDLLVRLQKEQGMALVLITHDMGVVAETAE
FT                   RVQVQYAGQKVEEQPVRALFRDPHHPYTAALLAALPERAKVGQRLPSIAGVVPGQHGRP
FT                   TGCLFAPRCGFATVECDRGVVRQGPELGLALCNYPLKDGKPLGHPGIMAVETAGDLV"
     MPLLEIENLT VEFQTSSGLF RAVDGVSLAC DKGEILSVVG ESGSGKSVAM LALMGLLPWT        60
     AKITADRMQF DGKDLRGISG RQRRRIVGKD MAMIFQEPMS SLNPCFTVGF QLGETLRFHM       120
     GLNRKERRQR SIELLNLVGI PAPEDRLSNF PHQMSGGMSQ RVMIAMALAC NPKLLIADEP       180
     TTALDVTIQA QILDLLVRLQ KEQGMALVLI THDMGVVAET AERVQVQYAG QKVEEQPVRA       240
     LFRDPHHPYT AALLAALPER AKVGQRLPSI AGVVPGQHGR PTGCLFAPRC GFATVECDRG       300
     VVRQGPELGL ALCNYPLKDG KPLGHPGIMA VETAGDLV                               338
//

If you have problems or comments...

PBIL Back to PBIL home page