(data stored in ACNUC7421 zone)

EMBL: CP001622.PE424

CP001622.PE424       Location/Qualifiers
FT   CDS             442907..443860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0426"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ret:RHE_CH00740 dipeptide transporter
FT                   ATP-binding subunit; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54736"
FT                   /db_xref="GOA:C6B1L7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L7"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS54736.1"
FT                   /translation="MTDAVLEGRDLARFYTVNRGLFKADATVKALNGVSFSLHSGKTLA
FT                   VVGESGCGKSTLARLVTMIENPTSGQLLIDGKPAHVGDRSLRSQVQIVFQNPYGSLNPR
FT                   QKVGSILEEPLKINTNLDGAARRRKAEEMMARVGLRPEHYGRYPHMFSGGQRQRIAIAR
FT                   ALMLRPKVLVLDEPVSALDLSIQAQVLNLLMDLQKEMGLAYLFISHGLSVVHHIADEVM
FT                   VMYLGRPVETGPAAEVFARPRHPYTAALLSATPIADPDRAKNRIRLQGELPSPLKPPTG
FT                   CHFNPRCWKAQDHCRQVSPELSGEGTHQYACHFPLD"
     MTDAVLEGRD LARFYTVNRG LFKADATVKA LNGVSFSLHS GKTLAVVGES GCGKSTLARL        60
     VTMIENPTSG QLLIDGKPAH VGDRSLRSQV QIVFQNPYGS LNPRQKVGSI LEEPLKINTN       120
     LDGAARRRKA EEMMARVGLR PEHYGRYPHM FSGGQRQRIA IARALMLRPK VLVLDEPVSA       180
     LDLSIQAQVL NLLMDLQKEM GLAYLFISHG LSVVHHIADE VMVMYLGRPV ETGPAAEVFA       240
     RPRHPYTAAL LSATPIADPD RAKNRIRLQG ELPSPLKPPT GCHFNPRCWK AQDHCRQVSP       300
     ELSGEGTHQY ACHFPLD                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page