(data stored in ACNUC7421 zone)

EMBL: CP001622.PE425

CP001622.PE425       Location/Qualifiers
FT   CDS             443982..444518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0427"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000820 gluconokinase protein;
FT                   TIGRFAM: carbohydrate kinase, thermoresistant glucokinase
FT                   family; PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54737"
FT                   /db_xref="GOA:C6B1L8"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L8"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACS54737.1"
FT                   /translation="MPEQMNKPQAIIVMGVSGCGKSSVGEKLAEALHLAFVEGDALHPA
FT                   ANVEKMSKGIALTDEDRMPWLDRIGEDMKASLEKSKGIIVSCSALKRLYRDRLRAAAGG
FT                   NLFFVYLEGSRALLMKRMGERKGHFMPVSLLDSQLATLEVPTGEPGVVTVDIDDTIDGI
FT                   AATALKSLAALGVTG"
     MPEQMNKPQA IIVMGVSGCG KSSVGEKLAE ALHLAFVEGD ALHPAANVEK MSKGIALTDE        60
     DRMPWLDRIG EDMKASLEKS KGIIVSCSAL KRLYRDRLRA AAGGNLFFVY LEGSRALLMK       120
     RMGERKGHFM PVSLLDSQLA TLEVPTGEPG VVTVDIDDTI DGIAATALKS LAALGVTG         178
//

If you have problems or comments...

PBIL Back to PBIL home page