(data stored in ACNUC7421 zone)

EMBL: CP001622.PE426

CP001622.PE426       Location/Qualifiers
FT   CDS             complement(444508..445755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0428"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rec:RHECIAT_CH0000821 putative D-amino acid dehydrogenase
FT                   protein; SNP /replace=C"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54738"
FT                   /db_xref="GOA:C6B1L9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L9"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS54738.1"
FT                   /translation="MTKNAIVLGAGIVGVSTAIHLQRRGRQVTLIDRKDPGNETSFGNA
FT                   GLIQREGVAPYGFPQQLGLLLRYAVNNRIDAHYHLRALPSQIAFLARYWWNSNARRHAI
FT                   ITRAYAPLIENSVVEHKDLIEASQAEGLIRKDGWIKIFRTEAKRDGALAEAALWQNEFG
FT                   VEYDSLTPADIARMEPYMTGDFAGGIRWRDPWSVLDPHALTSAYRRYFESLGGRFVTGD
FT                   AASLGPFGSGWKIMTAEGPLEAEDAVMALGPWAAVATRRLGYSFPLGVKRGYHMHYAAG
FT                   GNAVLNNWMLDAERGYLLAPMNRGIRLTTGAEFATLDAPKTPVQLDRAEAVARTIFPLG
FT                   DRLDPEPWMGARPCTPDMMPVIGKAPRHQGLWFAFGHAHHGLTLGPVTGRVLAELITGE
FT                   TPFIDISAYSPQRFNP"
     MTKNAIVLGA GIVGVSTAIH LQRRGRQVTL IDRKDPGNET SFGNAGLIQR EGVAPYGFPQ        60
     QLGLLLRYAV NNRIDAHYHL RALPSQIAFL ARYWWNSNAR RHAIITRAYA PLIENSVVEH       120
     KDLIEASQAE GLIRKDGWIK IFRTEAKRDG ALAEAALWQN EFGVEYDSLT PADIARMEPY       180
     MTGDFAGGIR WRDPWSVLDP HALTSAYRRY FESLGGRFVT GDAASLGPFG SGWKIMTAEG       240
     PLEAEDAVMA LGPWAAVATR RLGYSFPLGV KRGYHMHYAA GGNAVLNNWM LDAERGYLLA       300
     PMNRGIRLTT GAEFATLDAP KTPVQLDRAE AVARTIFPLG DRLDPEPWMG ARPCTPDMMP       360
     VIGKAPRHQG LWFAFGHAHH GLTLGPVTGR VLAELITGET PFIDISAYSP QRFNP            415
//

If you have problems or comments...

PBIL Back to PBIL home page