(data stored in ACNUC7421 zone)

EMBL: CP001622.PE427

CP001622.PE427       Location/Qualifiers
FT   CDS             complement(445832..446335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0429"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: ret:RHE_CH00743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54739"
FT                   /db_xref="GOA:C6B1M0"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M0"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ACS54739.1"
FT                   /translation="MMWPSIALLAFVTLQRLAELVLARRNTAALLSRGAREVAPEHYPT
FT                   MVALHAGWIIGLWLLAPGRPVAFFWFLVFMGLQALRLWVLATLKGRWTTRIIVLPGAPL
FT                   VRSGPYRFLRHPNYAIVVGEIAVLPLAFGLPLYAIVFSLLNALILHVRVKAENAALKSA
FT                   MILK"
     MMWPSIALLA FVTLQRLAEL VLARRNTAAL LSRGAREVAP EHYPTMVALH AGWIIGLWLL        60
     APGRPVAFFW FLVFMGLQAL RLWVLATLKG RWTTRIIVLP GAPLVRSGPY RFLRHPNYAI       120
     VVGEIAVLPL AFGLPLYAIV FSLLNALILH VRVKAENAAL KSAMILK                     167
//

If you have problems or comments...

PBIL Back to PBIL home page