(data stored in ACNUC7421 zone)

EMBL: CP001622.PE428

CP001622.PE428       Location/Qualifiers
FT   CDS             complement(446332..447384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0430"
FT                   /product="chalcone and stilbene synthase domain protein"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   FAE1/Type III polyketide synthase-like protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: rec:RHECIAT_CH0000823 probable chalcone
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54740"
FT                   /db_xref="GOA:C6B1M1"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M1"
FT                   /inference="protein motif:PFAM:PF02797"
FT                   /protein_id="ACS54740.1"
FT                   /translation="MTDTVKLVSLAVATPEHVIFQKQAVEASARLFADRFEDFRHLARV
FT                   FDSAGIDKRHAARPLAWFDEPHGWQDRMQAFAEVAGGLFVEAASSALRQAGLETGDVDC
FT                   VVTVSSTGFTTPSLDAQLAGRMGFRPDIERVPVFGLGCAAGVSGFAIASRLARSRPGTV
FT                   VLFVSIELCTLAFRLDELTRPNIIATALFGDGAAACVLRSGEDGLAEVESTGEHLFPDT
FT                   LDIMGWKIDDGGFGIVLAQSLPPFAEKELGPAVTAILARNGLRVEDIDRFICHPGGMKV
FT                   LAAMESALSMVPGTLDHERAVLAEYGNMSSPTILFVLERAIRAGLPARAAMIAMGPGFS
FT                   ASCVTLRRVA"
     MTDTVKLVSL AVATPEHVIF QKQAVEASAR LFADRFEDFR HLARVFDSAG IDKRHAARPL        60
     AWFDEPHGWQ DRMQAFAEVA GGLFVEAASS ALRQAGLETG DVDCVVTVSS TGFTTPSLDA       120
     QLAGRMGFRP DIERVPVFGL GCAAGVSGFA IASRLARSRP GTVVLFVSIE LCTLAFRLDE       180
     LTRPNIIATA LFGDGAAACV LRSGEDGLAE VESTGEHLFP DTLDIMGWKI DDGGFGIVLA       240
     QSLPPFAEKE LGPAVTAILA RNGLRVEDID RFICHPGGMK VLAAMESALS MVPGTLDHER       300
     AVLAEYGNMS SPTILFVLER AIRAGLPARA AMIAMGPGFS ASCVTLRRVA                  350
//

If you have problems or comments...

PBIL Back to PBIL home page