(data stored in ACNUC7421 zone)

EMBL: CP001622.PE429

CP001622.PE429       Location/Qualifiers
FT   CDS             447553..448089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0431"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   rec:RHECIAT_CH0000824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54741"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M2"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACS54741.1"
FT                   /translation="MTIMTARIASLLLGGCLAASVVSGPVFAIGDDSSTTPVCKKGEIY
FT                   DQKTKKCVKQQSANVSDENRADYAYSLAKAGRYEEALAVLDTVKDQNTAEVLNYRGYAT
FT                   RKLGRTDEGISYYLQSVKMDPQYAKVREYLGEAYVIKGQLDLAKDQLKTIKAICGTGCE
FT                   EYQDLNAVILDPSKI"
     MTIMTARIAS LLLGGCLAAS VVSGPVFAIG DDSSTTPVCK KGEIYDQKTK KCVKQQSANV        60
     SDENRADYAY SLAKAGRYEE ALAVLDTVKD QNTAEVLNYR GYATRKLGRT DEGISYYLQS       120
     VKMDPQYAKV REYLGEAYVI KGQLDLAKDQ LKTIKAICGT GCEEYQDLNA VILDPSKI         178
//

If you have problems or comments...

PBIL Back to PBIL home page