(data stored in ACNUC7421 zone)

EMBL: CP001622.PE43

CP001622.PE43        Location/Qualifiers
FT   CDS             complement(38688..40268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0044"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; polysaccharide
FT                   biosynthesis protein; multi antimicrobial extrusion protein
FT                   MatE; KEGG: rec:RHECIAT_CH0000426 virulence factor
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54355"
FT                   /db_xref="GOA:C6AYD1"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD1"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ACS54355.1"
FT                   /translation="MSLVKKFATVGGATLGSRIFGFARETLMAAALGTGPMADVFYAAF
FT                   RFPNLFRRLFAEGAFNAAFVPLFAKEIEANGTDGAKRFSEEVFGVLFSVLLLITIVMEL
FT                   AMPLLVRFVIAPGFADDPEKFSITIRMAAVMFPYLMCMSLTAMMSGMLNSLHHFFAAAI
FT                   APVFLNVVMIGALFYALYTGADPLATAWYLSWGVLAAGVLQLAVVYVGVLAAGMSIGFR
FT                   FPKMTPNVKRLLILAVPAAVTGGITQINQLIGQAIASSRDGAIAALQYADRIYQLPLGV
FT                   VGVAVGVVLLPELARALKGGNLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLY
FT                   ERGAFHQENTAVVGSILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCA
FT                   TALTLFPYMGAPGIAVAEATAGWISTVLLFATLLRRGHLTWEWALAKRTALLIVAAAVM
FT                   GAAIVFLKQYWAPSLASGAPLLTKIGTLGLLIAIAMLIYFAAAFLVGGANLGMIRRNLN
FT                   RKPAPAKDG"
     MSLVKKFATV GGATLGSRIF GFARETLMAA ALGTGPMADV FYAAFRFPNL FRRLFAEGAF        60
     NAAFVPLFAK EIEANGTDGA KRFSEEVFGV LFSVLLLITI VMELAMPLLV RFVIAPGFAD       120
     DPEKFSITIR MAAVMFPYLM CMSLTAMMSG MLNSLHHFFA AAIAPVFLNV VMIGALFYAL       180
     YTGADPLATA WYLSWGVLAA GVLQLAVVYV GVLAAGMSIG FRFPKMTPNV KRLLILAVPA       240
     AVTGGITQIN QLIGQAIASS RDGAIAALQY ADRIYQLPLG VVGVAVGVVL LPELARALKG       300
     GNLREAGNLQ NRSIEFVLFL TIPAAFALWI LSDEIIRVLY ERGAFHQENT AVVGSILAIY       360
     GIGLPAFVLI KALQPGFYAR EDTKTPMRFS AIAVATNCAT ALTLFPYMGA PGIAVAEATA       420
     GWISTVLLFA TLLRRGHLTW EWALAKRTAL LIVAAAVMGA AIVFLKQYWA PSLASGAPLL       480
     TKIGTLGLLI AIAMLIYFAA AFLVGGANLG MIRRNLNRKP APAKDG                      526
//

If you have problems or comments...

PBIL Back to PBIL home page