(data stored in ACNUC7421 zone)

EMBL: CP001622.PE430

CP001622.PE430       Location/Qualifiers
FT   CDS             448138..448743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0432"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000825 RNA polymerase sigma factor protein
FT                   (sigma-24)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54742"
FT                   /db_xref="GOA:C6B1M3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS54742.1"
FT                   /translation="MSVARTHFPAYSHARMESPVHPAVSRDRGLAEAAIASEADIRSGL
FT                   TENLARLWRYGLVLSHQRDVADDLVQATCLRALERADQFIPGTRLDRWLFSILHSIWLN
FT                   EIRSRRVRQGQGFVDAGETLTFDGAHDTETQVMAHQVLKQVNALPEAQRTVVFLAYVEG
FT                   LSYREVAGILDIPIGTVMSRLAAARAKLSGAGPEGGRQ"
     MSVARTHFPA YSHARMESPV HPAVSRDRGL AEAAIASEAD IRSGLTENLA RLWRYGLVLS        60
     HQRDVADDLV QATCLRALER ADQFIPGTRL DRWLFSILHS IWLNEIRSRR VRQGQGFVDA       120
     GETLTFDGAH DTETQVMAHQ VLKQVNALPE AQRTVVFLAY VEGLSYREVA GILDIPIGTV       180
     MSRLAAARAK LSGAGPEGGR Q                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page