(data stored in ACNUC7421 zone)

EMBL: CP001622.PE431

CP001622.PE431       Location/Qualifiers
FT   CDS             448740..449543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0433"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: rec:RHECIAT_CH0000826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54743"
FT                   /db_xref="GOA:C6B1M4"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000826"
FT                   /protein_id="ACS54743.1"
FT                   /translation="MTTKHTIPSDEDLTAFIDGELTAEEAARIEAIVKEDESTAERLEF
FT                   LARASLPFKQAFAPLLAEAPREKLETMLAAIPPQQSAKSGPTPAFATRRRFLGALAASL
FT                   VAGIAIDRAVIGIGARFSAKDENSEWRAVVADYISLYSAETLAGPVPGREDQAAQLAGL
FT                   DEKLGLSLSPEAVSLPGIDFKRALLLQYDGKPLAQIAYLDPETGPMALCIVRSDAGPKA
FT                   PDLESRKGMNVAYWSNATHAFMLIGRIPVDRVQELAENARSRLSA"
     MTTKHTIPSD EDLTAFIDGE LTAEEAARIE AIVKEDESTA ERLEFLARAS LPFKQAFAPL        60
     LAEAPREKLE TMLAAIPPQQ SAKSGPTPAF ATRRRFLGAL AASLVAGIAI DRAVIGIGAR       120
     FSAKDENSEW RAVVADYISL YSAETLAGPV PGREDQAAQL AGLDEKLGLS LSPEAVSLPG       180
     IDFKRALLLQ YDGKPLAQIA YLDPETGPMA LCIVRSDAGP KAPDLESRKG MNVAYWSNAT       240
     HAFMLIGRIP VDRVQELAEN ARSRLSA                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page