(data stored in ACNUC7421 zone)

EMBL: CP001622.PE432

CP001622.PE432       Location/Qualifiers
FT   CDS             complement(449572..450435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0434"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: atc:AGR_L_532
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54744"
FT                   /db_xref="GOA:C6B1M5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M5"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ACS54744.1"
FT                   /translation="MKGIVLAGGSGSRLHPMTHAVSKQLLPIYDKPMIYYPLTTLMLAG
FT                   IREVLIISTPHDMPLFQRLLGDGSEWGMSLSYAVQPSPDGLAQAYIIGADFVAGGPSCL
FT                   ILGDNIYFGHGLPELLEEGVSKGDGATIFAYHVHDPERYGVVEFGSDMTAISIEEKPAK
FT                   PKSHWAVTGLYFYDADVVDIAANLKPSARGEYEITDVNKTYLERGKLRVSMMGRGYAWL
FT                   DTGTPESLLEAGGFVRTLEKRQGFKIACPEEIALAKGFITKERFAQIAAQAGKGDYGQY
FT                   LRGLVD"
     MKGIVLAGGS GSRLHPMTHA VSKQLLPIYD KPMIYYPLTT LMLAGIREVL IISTPHDMPL        60
     FQRLLGDGSE WGMSLSYAVQ PSPDGLAQAY IIGADFVAGG PSCLILGDNI YFGHGLPELL       120
     EEGVSKGDGA TIFAYHVHDP ERYGVVEFGS DMTAISIEEK PAKPKSHWAV TGLYFYDADV       180
     VDIAANLKPS ARGEYEITDV NKTYLERGKL RVSMMGRGYA WLDTGTPESL LEAGGFVRTL       240
     EKRQGFKIAC PEEIALAKGF ITKERFAQIA AQAGKGDYGQ YLRGLVD                     287
//

If you have problems or comments...

PBIL Back to PBIL home page