(data stored in ACNUC7421 zone)

EMBL: CP001622.PE433

CP001622.PE433       Location/Qualifiers
FT   CDS             complement(450432..451325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0435"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="KEGG: atc:AGR_L_531 dTDP-4-dehydrorhamnose
FT                   reductase; TIGRFAM: dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase; NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54745"
FT                   /db_xref="GOA:C6B1M6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M6"
FT                   /inference="protein motif:TFAM:TIGR01214"
FT                   /protein_id="ACS54745.1"
FT                   /translation="MRIAVTGKSGQVTSALQALNVPGIEIIAIGRPELDLLEPSMVSEI
FT                   IAKIKPDVVVSSAAYTAVDKAESDEAAAFAINRDGAKAIAAATAELSLPVIHLSTDYVF
FT                   DGDKPECYVESDPVGPVSVYGRSKLEGEYAVAAANENHVILRTAWVYSTFGHNFVITML
FT                   RLAETREELSVVSDQLGCPTSAGDIAGAIVKIAGRLSNDSTPDLRGVCHLAGSGETSCA
FT                   GFARYILSIHEEKTGRRVTVKDIATADYPTAAKRPANSRLCCDKLKSLYSVSMPEWRIS
FT                   ARAAVTKLLEEPKEAV"
     MRIAVTGKSG QVTSALQALN VPGIEIIAIG RPELDLLEPS MVSEIIAKIK PDVVVSSAAY        60
     TAVDKAESDE AAAFAINRDG AKAIAAATAE LSLPVIHLST DYVFDGDKPE CYVESDPVGP       120
     VSVYGRSKLE GEYAVAAANE NHVILRTAWV YSTFGHNFVI TMLRLAETRE ELSVVSDQLG       180
     CPTSAGDIAG AIVKIAGRLS NDSTPDLRGV CHLAGSGETS CAGFARYILS IHEEKTGRRV       240
     TVKDIATADY PTAAKRPANS RLCCDKLKSL YSVSMPEWRI SARAAVTKLL EEPKEAV          297
//

If you have problems or comments...

PBIL Back to PBIL home page