(data stored in ACNUC7421 zone)

EMBL: CP001622.PE434

CP001622.PE434       Location/Qualifiers
FT   CDS             complement(452396..452962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0437"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: atc:AGR_L_529 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54746"
FT                   /db_xref="GOA:C6B1M7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M7"
FT                   /inference="protein motif:TFAM:TIGR01221"
FT                   /protein_id="ACS54746.1"
FT                   /translation="MYALKVEQLEIGDVKKVTPARFGDPRGYFSEVFKDFWFRTNVADV
FT                   SFVQDNESLSAQPGTVRGLHFQSPPFAQGKLVRCLRGALLDVAVDIRHGSPTYGKWVSA
FT                   ELSPENGSQLWVPAGFAHGFVTLEPDTIISYKVTALYSAEHDCGVRWNDAEIGIEWPQM
FT                   DGYVLSDKDNKQPRLSELPTYFQFS"
     MYALKVEQLE IGDVKKVTPA RFGDPRGYFS EVFKDFWFRT NVADVSFVQD NESLSAQPGT        60
     VRGLHFQSPP FAQGKLVRCL RGALLDVAVD IRHGSPTYGK WVSAELSPEN GSQLWVPAGF       120
     AHGFVTLEPD TIISYKVTAL YSAEHDCGVR WNDAEIGIEW PQMDGYVLSD KDNKQPRLSE       180
     LPTYFQFS                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page