(data stored in ACNUC7421 zone)

EMBL: CP001622.PE435

CP001622.PE435       Location/Qualifiers
FT   CDS             complement(453209..454129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0438"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: ret:RHE_CH00763
FT                   GDP-L-fucose synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54747"
FT                   /db_xref="GOA:C6B1M8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M8"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54747.1"
FT                   /translation="MNRDVKIYVAGHRGMVGSAIVRRLKAGGYTNIVTRSHAELDLVNQ
FT                   AAVAEFMKAERPDYIFMAAARVGGIHANNVYRAEFLYQNLMIETNVVHAAWQAGVERML
FT                   FLGSSCIYPRDCPQPIREEYLLTGPLEQTNEAYAIAKIAGVKLCESYNRQYGTRYVSGM
FT                   PTNLYGPNDNYDLDSSHVMPALIRKVHEAKIRGDRQLVVWGSGRPMREFLYVDDMADAC
FT                   VFLMEKEVSEGLINIGTGEDITIRELAETIMRVVGFTGEIVYDQTKPDGTPRKLMSVDR
FT                   LSALGWKATTSLGDGIARAYADFAS"
     MNRDVKIYVA GHRGMVGSAI VRRLKAGGYT NIVTRSHAEL DLVNQAAVAE FMKAERPDYI        60
     FMAAARVGGI HANNVYRAEF LYQNLMIETN VVHAAWQAGV ERMLFLGSSC IYPRDCPQPI       120
     REEYLLTGPL EQTNEAYAIA KIAGVKLCES YNRQYGTRYV SGMPTNLYGP NDNYDLDSSH       180
     VMPALIRKVH EAKIRGDRQL VVWGSGRPMR EFLYVDDMAD ACVFLMEKEV SEGLINIGTG       240
     EDITIRELAE TIMRVVGFTG EIVYDQTKPD GTPRKLMSVD RLSALGWKAT TSLGDGIARA       300
     YADFAS                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page